Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR309 IGR308 IGR305 IGR306 IGR307 UU366 asnS, - UU365 UU367 deoA, - UU368 leuS, - UU371 alaS, - UU369 UU366 asnS, - UU365 UU367 deoA, - UU368 leuS, - UU371 alaS, - UU369 Type: tandem, Name:  - 236 Type: tandem, Name:  - 233 Type: tandem, Name:  - 448 Type: tandem, Name:  - 234 Type: tandem, Name:  - 235 Type: tandem, Name:  - 237 UU366 asnS, - UU365 UU367 psgA, - UU364 psgA, - UU364 deoA, - UU368 leuS, - UU371 alaS, - UU369 UU370 UU370
* Calculated from Protein Sequence

Gene ID: UU368

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
deoA  

Definition:
thymidine phosphorylase

Gene Start:
418752

Gene Stop:
420053

Gene Length:
1302

Molecular Weight*:
48667

pI*:
8.10

Net Charge*:
1.89

EC:
2.4.2.4  

Functional Class:
purines, pyrimidines, nucleosides, and nucleotides; salvage of nucleosides and nucleotides  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Comment:
See UU281, a predicted deoD sequence; UU470, a predicted deoD sequence; and UU585, a predicted deoC sequence.

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to thymidine phosphorylase (TYPH) sequences, e.g. residues 2-410 are 46% similar to TYPH_MYCPI. More distant matches are to TRPD sequences. UU368 is also similar to MG051, a predicted TYPH sequence. No similarity to T.pallidum or C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0213 is e-gp-m--.
Cog name: Thymidine phosphorylase.
Functional class: F.
BeTs to e--p-m--.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 7-319 span seven regions of similarity to blocks BL00647A-G, which encompass thymidine and pyrimidine-nucleoside phosphorylases, e.g. TYPH_ECOLI, PDP_BACSU.

ProDom Summary:  Protein Domain Search
Residues 2-410 are 46% similar to a TYPH domain of TYPH_MYCPI.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 4 to 68 (E-value = 2.3e-15) place UU368 in the Glycos_trans_3N family which is described as Glycosyl transferase family, helical bundle domain (PF02885)
Residues 76 to 329 (E-value = 3.6e-27) place UU368 in the Glycos_transf_3 family which is described as Glycosyl transferase family, a/b domain (PF00591)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
66  
203

PDB Hit:
gi|4389236|pdb|1BRW|B Chain B, The Crystal Structure Of Pyrimidine Nucleoside Phosphorylase In A Closed Conformation

Gene Protein Sequence:
MLNVVEIISKKKNNIELSEQEIKFVYDGFVNKTIPDYQMAAFLMAVNFCG
YSENEQYYATKAMVESGKLLDLRVENKIVVDKHSSGGVGDKVSIILTPLL
SALGLYVGKMSGRGLGHTGGTVDKLESLNLNLDFDLKTYMNQLKDNGLLL
TGQSDDMVVADKYIYALRDVTATSDVFDLMIGSIMAKKLALITDYIFLDV
KVGEGAFCKNVAQAESLATKMLKLSKKFNRNTIIHLTNMDQPLGKAIGNA
IEIKESMDYLLGKPVPQDLYDLINQFALDILIDTKFAKNKEDAQSKIDNV
IKNGLAYQKFVNWVKWYKGDYISLENDTYFNPKYKLEILAKQDGYLDFKS
TKELGMIAVDLKAGRKVKTDQLDFQAGIYLNKKNNDFVKTNEVIATLYAS
EPINDEVVNKYHNNVVYLKTPKQIAPSIIKVMR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAAATGTTGTAGAAATTATTAGCAAGAAAAAAAATAATATTGAATT
AAGTGAACAAGAAATTAAATTTGTTTATGATGGTTTTGTTAATAAGACAA
TTCCAGATTATCAAATGGCAGCTTTTTTAATGGCTGTTAATTTTTGTGGA
TATAGTGAAAATGAACAATACTATGCAACTAAAGCAATGGTTGAATCTGG
TAAATTATTAGATTTGCGTGTTGAAAATAAAATTGTTGTTGACAAACATT
CATCTGGTGGTGTGGGAGATAAAGTTTCAATTATTTTAACTCCTTTACTA
TCAGCTTTAGGATTATACGTTGGAAAAATGTCTGGTCGAGGATTAGGGCA
TACTGGTGGTACAGTTGATAAATTAGAATCATTGAATTTAAATTTAGATT
TTGATTTAAAAACATACATGAATCAGCTAAAAGATAATGGTTTATTATTA
ACTGGTCAATCAGATGATATGGTTGTGGCTGATAAATATATTTATGCATT
ACGAGATGTAACAGCAACAAGTGATGTGTTTGATCTTATGATAGGATCAA
TTATGGCTAAAAAATTAGCTTTAATTACTGATTATATTTTCTTAGATGTT
AAAGTTGGTGAAGGAGCATTTTGTAAAAATGTTGCACAAGCAGAATCTTT
AGCAACAAAGATGTTAAAATTATCAAAGAAATTTAATCGTAATACAATTA
TCCATTTAACAAATATGGACCAACCTTTAGGAAAAGCAATTGGTAATGCT
ATTGAAATTAAAGAAAGTATGGATTATTTATTAGGTAAACCAGTGCCCCA
AGATTTATATGATTTAATTAATCAGTTTGCTTTAGACATCTTAATTGATA
CAAAATTCGCTAAAAACAAGGAAGATGCTCAATCTAAGATTGATAACGTC
ATTAAAAATGGTTTAGCTTATCAAAAATTTGTGAATTGAGTAAAATGATA
CAAAGGTGATTATATTAGTCTTGAAAATGATACATATTTTAACCCTAAAT
ACAAATTAGAGATTTTAGCAAAACAAGATGGATATTTAGACTTTAAATCA
ACAAAAGAATTGGGTATGATTGCTGTTGATTTAAAAGCAGGACGTAAAGT
TAAAACTGATCAATTAGATTTTCAAGCTGGAATTTATTTAAATAAGAAAA
ATAATGATTTCGTTAAAACAAATGAAGTTATTGCTACACTTTATGCTAGC
GAGCCAATTAATGATGAAGTTGTTAATAAATACCATAACAATGTAGTTTA
TTTAAAAACACCAAAACAAATTGCACCATCAATTATTAAAGTAATGCGTT
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy