Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR308 IGR304 IGR303 IGR305 IGR306 IGR302 IGR307 UU366 asnA, - UU363 asnS, - UU365 gapN, - UU362 UU367 UU361 deoA, - UU368 UU360 alaS, - UU369 UU366 asnA, - UU363 asnS, - UU365 gapN, - UU362 UU367 UU361 deoA, - UU368 UU360 alaS, - UU369 Type: tandem, Name:  - 236 Type: tandem, Name:  - 233 Type: tandem, Name:  - 447 Type: tandem, Name:  - 234 Type: tandem, Name:  - 235 Type: tandem, Name:  - 414 Type: tandem, Name:  - 448 UU366 asnA, - UU363 asnS, - UU365 gapN, - UU362 UU367 psgA, - UU364 psgA, - UU364 UU361 deoA, - UU368 UU360 alaS, - UU369
* Calculated from Protein Sequence

Gene ID: UU365

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
asnS  

Definition:
asparaginyl-tRNA synthetase

Gene Start:
416130

Gene Stop:
414766

Gene Length:
1365

Molecular Weight*:
52303

pI*:
5.60

Net Charge*:
-9.40

EC:
6.1.1.22  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Alanine and Aspartate metabolism
Aminoacyl-tRNA biosynthesis

Comment:
The complete list of predicted and possible tRNA synthetases is: UU062, UU106, UU117, UU123, UU175, UU192, UU197, UU267, UU278, UU285, UU286, UU287, UU365, UU369, UU371, UU410, UU452, UU457, UU458, UU493, UU534, and UU599.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to asparaginyl-tRNA synthetases, e.g. residues 5-454 are 46% similar to SYN_MYCPN. UU365 is also similar to MG113 and TP0609, predicted asparaginyl-tRNA synthetases. No similarity to C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0017 is EHGPCmYu.
Cog name: Lysyl/asparaginyl/aspartyl-tRNA synthetases.
Functional class: J.
BeTs to -h-pcmy-.
Number of proteins in this genome belonging to this COG is 2



Blocks Summary:  Blocks Search
Residue 21-43, 139-163, 195231, and 408-446 are similar to blocks PF00152A-D, which encompass class II tRNA synthetases, e.g. SYN_BACSU, SYN_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 134-346 and 347-452 are 50% and 56% similar to asn-tRNA synthetase domains of SYN_MYCPN.

Paralogs:  Local Blast Search
UU365 is paralogously related to UU062, a predicted lysyl-tRNA synthetase.

Pfam Summary:  Pfam Search
Residues 21 to 100 (E-value = 2.1e-07) place UU365 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)
Residues 115 to 450 (E-value = 1.3e-100) place UU365 in the tRNA-synt_2 family which is described as tRNA synthetases class II (D, K and N) (PF00152)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
259  
310

PDB Hit:
gi|4388836|pdb|1B8A|A Chain A, Aspartyl Trna Synthetase From Pyrococcus Kodakaraensis

Gene Protein Sequence:
MQLKIKEIFNQDYVKLEGQKIQIKAWVRSNRDSKKIGFLVLNDGSSLTNL
QAVYRVDKIDNYEEIAAARMWAAVVIEGVIKLTPTAKQPLELEVLNAQIL
KQSDEDFLLSNNDLNLETLRLNAHLRPRTNLFHAIMKVRATLAFAVHEFM
NQNEYSWLAAPLFTGNDAEGAGETFSIQKFDNEEFFGKQTHLSVTGQLQA
EAYAQAFGNVYTFGPTFRAEKSHTNRHLAEFWMIEPEMAFVDLKGMQDIV
EDLVKHVIKAVLEKNQQELEFLAQRNDENLIKKLQKVVESKFERIEYKDA
VKILADAVKNGHQFENNEIFFGMDLGSEHERYMCETYHQGPVFLQNYPKD
IKAFYMKLNDDQQTVASTDLLIPGVGELVGGSQREDSYEKLLKRCQELKM
PIESLQWYLDLRRFGYYMSSGFGIGFERLVMYVTGVNNIKDTIPFPRSHG
QIEF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAATTAAAAATTAAAGAAATTTTTAATCAAGACTATGTAAAACTTGA
AGGCCAAAAGATACAAATTAAAGCTTGAGTTCGTTCAAACCGTGATTCAA
AAAAAATTGGTTTTTTAGTTCTAAATGATGGTAGTTCTTTAACAAATTTA
CAAGCTGTATATCGTGTTGATAAAATTGACAATTATGAAGAAATAGCTGC
AGCACGAATGTGAGCCGCTGTTGTTATTGAAGGTGTAATTAAATTAACTC
CAACAGCTAAACAACCATTAGAACTAGAAGTATTAAATGCTCAAATTTTA
AAACAAAGTGATGAAGATTTTTTATTATCAAACAATGATTTAAATTTAGA
AACATTGCGTTTAAATGCTCATTTAAGACCAAGAACAAATTTATTTCATG
CCATTATGAAAGTGAGGGCAACACTTGCTTTTGCAGTTCATGAATTTATG
AATCAAAACGAATATAGTTGATTAGCTGCACCATTGTTTACAGGAAATGA
TGCTGAAGGAGCTGGCGAAACTTTTAGTATTCAAAAATTTGATAATGAAG
AATTTTTTGGTAAACAAACTCATTTATCTGTAACAGGTCAATTACAAGCT
GAAGCATACGCACAAGCTTTTGGTAATGTTTATACATTTGGTCCTACTTT
TAGAGCTGAAAAATCTCACACAAATCGTCATTTAGCAGAATTTTGAATGA
TTGAACCTGAAATGGCTTTTGTTGATTTAAAAGGTATGCAAGATATTGTT
GAAGATTTAGTTAAACATGTTATTAAGGCTGTTTTAGAAAAAAATCAACA
AGAATTAGAATTTTTAGCTCAAAGAAATGATGAAAATTTAATTAAAAAAC
TACAAAAAGTTGTTGAGTCTAAATTTGAACGTATTGAATATAAAGATGCA
GTTAAAATCCTAGCTGATGCTGTTAAAAATGGTCATCAATTCGAAAATAA
TGAAATCTTTTTTGGAATGGATTTAGGATCAGAGCACGAAAGATACATGT
GTGAAACATATCATCAAGGTCCTGTGTTCTTACAAAATTATCCAAAGGAT
ATTAAAGCATTTTATATGAAATTAAACGATGATCAACAAACTGTAGCTTC
AACAGATTTATTAATTCCAGGCGTTGGCGAATTAGTGGGTGGATCACAAC
GTGAAGATAGTTATGAGAAACTATTAAAACGATGTCAAGAATTAAAAATG
CCAATTGAAAGTTTACAATGATATTTAGATTTACGTCGTTTCGGATATTA
TATGTCATCAGGTTTTGGAATTGGTTTTGAGCGTTTAGTGATGTATGTAA
CAGGAGTTAATAATATTAAAGATACAATCCCATTCCCACGAAGTCATGGC
CAAATTGAATTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy