Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR304 IGR303 IGR305 IGR306 IGR302 IGR307 UU366 asnA, - UU363 asnS, - UU365 gapN, - UU362 UU367 UU361 deoA, - UU368 UU360 UU366 asnA, - UU363 asnS, - UU365 gapN, - UU362 UU367 UU361 deoA, - UU368 UU360 Type: tandem, Name:  - 236 Type: tandem, Name:  - 233 Type: tandem, Name:  - 447 Type: tandem, Name:  - 234 Type: tandem, Name:  - 235 Type: tandem, Name:  - 414 Type: tandem, Name:  - 448 UU366 asnA, - UU363 asnS, - UU365 gapN, - UU362 UU367 psgA, - UU364 psgA, - UU364 UU361 deoA, - UU368 UU360
* Calculated from Protein Sequence

Gene ID: UU364

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
psgA  

Definition:
phosphatidylglycerophosphate synthase

Gene Start:
414785

Gene Stop:
414129

Gene Length:
657

Molecular Weight*:
24627

pI*:
10.60

Net Charge*:
13.08

EC:
2.7.8.5  

Functional Class:
fatty acid and phospholipid metabolism; biosynthesis  

Pathway: pathway table
Glycerolipid metabolism

Comment:
Reevaluate start codon.

Blast Summary:  PSI-Blast Search
Several weak hits in gapped BLAST to PSGA sequences, e.g. residues 75-210 are 36% similar to PGSA_MYCPN. All similarities begin at around residue 75 of UU364. MG114, CT797, TP0256 and CT496 are predicted phosphatidylglycerophosphate synthases with similarities to UU364 beginning around residue 17.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0558 is ehgpcmYU.
Cog name: Phosphatidylglycerophosphate synthase.
Functional class: I.
BeTs to -h-pcmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 76-112 are similar to block BL00379 concerned with CDP-alcohol phosphatidyltransferase proteins,e.g. PGSA_MYCGE. Several stretches between residues 14 and 209 are similar to blocks PR00169A-D, which encompass potassium channel signatures, e.g. CIK6_HUMAN.

ProDom Summary:  Protein Domain Search
Residues 68-166 are 47% similar to the PGSA domains of PGSA_MYCGE, PGSA_MYCPN, PGSA_BACSU.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 66 to 204 (E-value = 3.8e-28) place UU364 in the CDP-OH_P_transf family which is described as CDP-alcohol phosphatidyltransferase (PF01066)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
19  
49
transmembrane  
53  
83
transmembrane  
103  
137
transmembrane  
143  
169
transmembrane  
173  
204

PDB Hit:


Gene Protein Sequence:
MAKLNFKKNISSSPFFRNIPNIITIFRIFLALICIILLLVDFYTKNLNIV
YEVLDANISALRLSATIIFIIAAFSDFLDGYIARKYNLVSNLGKILDPIS
DKILVNGVLICLTLDHTALAYLTIINILRDIFIDGLRMFASSKKIIIPAN
IFGKIKSILLFISICFILFLLSLTSSWKNVYLFNIPLFFATSLSVISGII
YYINFYKGVKKRGSITKS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCCAAATTGAATTTTAAAAAAAACATCTCATCATCACCTTTTTTTAG
AAACATTCCTAATATTATCACTATCTTTAGAATTTTTTTAGCACTTATTT
GCATCATCTTATTATTAGTTGATTTTTACACAAAAAATTTAAATATTGTC
TATGAAGTTTTAGATGCCAATATTAGTGCATTGCGTTTAAGTGCAACAAT
TATTTTTATTATTGCTGCTTTTTCTGATTTCTTAGATGGATATATAGCTC
GTAAATATAATTTAGTTTCAAATTTAGGGAAAATCTTAGATCCTATTTCT
GATAAAATCCTTGTTAATGGTGTTTTAATTTGTTTAACACTAGATCATAC
AGCACTAGCTTATTTAACAATTATTAATATCTTACGAGATATTTTTATTG
ATGGTTTACGAATGTTTGCTTCAAGTAAGAAAATTATTATTCCAGCAAAT
ATTTTTGGCAAAATTAAATCCATTCTACTATTTATTAGTATTTGCTTTAT
TTTATTTTTACTAAGCTTAACCTCATCATGAAAAAACGTTTATTTATTTA
ATATTCCTTTATTTTTTGCAACATCATTATCTGTAATCAGTGGTATTATT
TACTACATTAATTTTTACAAAGGAGTTAAAAAACGTGGATCAATTACAAA
AAGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy