Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR304 IGR303 IGR301 IGR305 IGR306 IGR302 IGR307 UU366 asnA, - UU363 asnS, - UU365 gapN, - UU362 UU367 UU361 UU360 UU359 UU366 asnA, - UU363 asnS, - UU365 gapN, - UU362 UU367 UU361 UU360 UU359 Type: tandem, Name:  - 414 Type: tandem, Name:  - 233 Type: tandem, Name:  - 448 Type: tandem, Name:  - 234 Type: tandem, Name:  - 235 Type: tandem, Name:  - 447 UU366 asnA, - UU363 asnS, - UU365 gapN, - UU362 UU367 psgA, - UU364 psgA, - UU364 UU361 UU360 UU359
* Calculated from Protein Sequence

Gene ID: UU363

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
asnA  

Definition:
asparagine synthetase A

Gene Start:
414151

Gene Stop:
413162

Gene Length:
990

Molecular Weight*:
38259

pI*:
7.00

Net Charge*:
0.00

EC:
6.3.1.1  

Functional Class:
amino acid biosynthesis; aspartate family  

Pathway: pathway table
Alanine and Aspartate metabolism
Cyanoamino acid metabolism
Nitrogen metabolism

Comment:


Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to ASNA sequences, e.g. residues 27-329 are 44% similar to ASNA_LACDE. Residues 13-320 are 41% similar to ASNS_HAEIN. UU363 is also similar to TP0556, a predicted asparagine synthetase A sequence. No similarity to M.genitalium or C.trachomatis.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
Residues 111-124 are similar to block PD02145A, concerned with Synthetase Phosphopantetheine ligase biosynthesis proteins, e.g. GRSA_BACBR.




ProDom Summary:  Protein Domain Search
Residues 27-316 are 45% similar to an ASNA domain of ASNS_LACDE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 6 to 240 (E-value = 6.3e-162) place UU363 in the AsnA family which is described as Aspartate-ammonia ligase (PF03590)

PDB Hit:
gi|4139528|pdb|11AS|A Chain A, Asparagine Synthetase Mutant C51a, C315a Complexed With L-Asparagine

Gene Protein Sequence:
VDQLQKAKINQTQKAIVEIKNSFQKHFAKNLNLSRVTAPLFVEGQSGLND
HLDHKQKAVSFYAKKLDKTLEIVQSLAKWKRLALLDYGFSLYEGLYTDMN
AIRADDDIDEIHSIYVDQWDWEILINNQDCNLDFLKSIVNKIYSTIRIVQ
LEIDQLYNPKQIILPDSITFISSQELEDLYPHLSPSRREYEFAKIHKAIF
IYQIGYPLKSGYIQSIRSPEYDNWNLNGDLIVYHKLNDQAIELSSMGIRV
SKQDFIKQTNFANLKNDQENNFYHQMILNNQLPQTIGGGIGQSRLCMFLL
NKKHIGEVQVSVWPNEYKDELLKKGIKLL$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGATCAATTACAAAAAGCTAAAATTAATCAAACACAAAAAGCAATTGT
AGAGATTAAAAATTCTTTTCAAAAACATTTTGCAAAAAATTTAAATCTTT
CACGTGTAACAGCACCATTATTTGTTGAAGGACAATCAGGTCTAAATGAT
CATTTAGACCATAAACAAAAAGCAGTAAGTTTTTATGCTAAAAAATTAGA
TAAAACACTTGAAATTGTTCAATCACTAGCAAAATGAAAACGTTTAGCTT
TATTAGATTATGGTTTTAGTTTATATGAAGGTTTGTATACTGATATGAAT
GCAATTCGTGCAGATGATGACATCGATGAAATTCATAGCATTTATGTTGA
TCAGTGAGATTGAGAAATTTTAATTAATAACCAAGATTGTAACTTAGATT
TTTTAAAATCAATCGTTAATAAAATTTATTCAACAATTAGAATTGTTCAA
TTAGAAATTGATCAATTATATAATCCAAAACAAATTATTTTACCAGATAG
TATTACTTTTATTAGTTCACAAGAATTAGAAGATTTATATCCACATTTAT
CACCATCTCGACGTGAATATGAGTTTGCAAAAATTCATAAAGCAATTTTT
ATATACCAAATTGGATATCCACTAAAATCAGGTTATATTCAATCAATACG
TTCTCCAGAATATGATAATTGAAATTTAAATGGAGATTTAATTGTTTATC
ATAAATTAAATGATCAAGCCATTGAATTATCATCAATGGGAATTCGTGTT
AGCAAACAAGATTTTATTAAGCAAACAAATTTTGCTAATTTAAAAAATGA
TCAAGAAAATAATTTTTATCATCAAATGATTTTAAATAATCAACTACCCC
AAACAATTGGTGGGGGAATCGGTCAAAGTCGTTTATGTATGTTTTTATTA
AACAAAAAACACATTGGTGAGGTACAAGTTTCAGTTTGACCAAATGAATA
TAAAGATGAATTGTTAAAAAAAGGGATTAAATTACTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy