Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR304 IGR303 IGR301 IGR305 IGR306 IGR300 IGR302 UU366 asnA, - UU363 asnS, - UU365 gapN, - UU362 UU367 UU361 fatC, - UU358 UU360 UU359 UU366 asnA, - UU363 asnS, - UU365 gapN, - UU362 UU367 UU361 fatC, - UU358 UU360 UU359 Type: tandem, Name:  - 235 Type: tandem, Name:  - 232 Type: tandem, Name:  - 447 Type: tandem, Name:  - 233 Type: tandem, Name:  - 234 Type: tandem, Name:  - 414 Type: tandem, Name:  - 448 UU366 asnA, - UU363 asnS, - UU365 gapN, - UU362 UU367 psgA, - UU364 psgA, - UU364 UU361 fatC, - UU358 UU360 UU359
* Calculated from Protein Sequence

Gene ID: UU362

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gapN  

Definition:
NADP-dependent glyceraldehyde-3-phosphate dehydrogenase

Gene Start:
413130

Gene Stop:
411703

Gene Length:
1428

Molecular Weight*:
52561

pI*:
7.60

Net Charge*:
2.43

EC:
1.2.1.9  

Functional Class:
energy metabolism; glycolysis and gluconeogenesis  

Pathway: pathway table

Comment:
See pathway (in enzyme pathways database) for E.C.# 1.2.1.12 and Prosite: PDOC00069, both of which treat NAD (rather than NADP) dependent glyceraldehyde 3-phosphate dehydrogenase.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to bacterial and plant GAPN sequences, e.g. residues 3-474 are 40% similar to GAPN_STRMU. Residues 16-474 are 40% similar to GAPN_PEA. No similarity to M.genitalium, T.pallidum or C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0506 is E---CmYu.
Cog name: NADH-dependent dehydrogenases.
Functional class: C.
BeTs to e---cmyu .
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 55-454 span six regions of similarity to blocks BL00687A-F, which encompass aldehyde dehydrogenase sequences, e.g. GAPN_NICPL, GAPN_STRMU.

ProDom Summary:  Protein Domain Search
Residues 143-219 and 225-320 are 57% and 56% similar, respectively, to dehydrogenase domains of Q49010_MYCCA.
Residues 382-474 are 46% similar to a domain of GAPN_PEA.


Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 11 to 475 (E-value = 3.9e-83) place UU362 in the Aldedh family which is described as Aldehyde dehydrogenase family (PF00171)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
67  
103
transmembrane  
140  
169

PDB Hit:
gi|5822059|pdb|1EUH|A Chain A, Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase From Streptococcus Mutans

Gene Protein Sequence:
LNYKTLINGAFVDAKEKLPVYNPSNNQIIAYVPNIHNENEINTIFENAHI
AYLKFKDTPIKYRCDLLLKLADKLDEHKQELAQIISTEIAKGLKDSLIEV
ERSADYLRETVFEYQKLMQKPIIFDETVHHVKNKVATYYRIPVGVVLAIC
PFNYPINLLISKLAPALVSGNSLVYKPSTQGSLIGIRISELVHEVGFPKG
VVNCLTTEARITGDLLVTNKYVKAISFTGGPKVGNHIAEITSKISLVLEL
GGKDPALVLDDADFELAANEIVKGAYGFSGQRCTAIKRVFVSHKNHDLLV
NLINKKVDALTVGLPQQNPIITPLINSNSLKYNLSLVEDAIKKGAIVHQK
IVYNEKNNLLHPLVIDNVTKEMRVAWEEPFGPILPIITYNSIQEAIDLIN
QSQYGLQACIFTTNYASIEQLALQIESGTININKSSSRGPDILPFFGVKD
SGFGVQGIVDAILSMTTIKGIIINK$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAACTATAAAACATTAATTAATGGAGCATTTGTTGATGCTAAAGAAAA
ACTACCAGTTTATAATCCATCTAATAATCAAATTATTGCTTATGTTCCTA
ACATTCATAATGAAAATGAAATTAATACTATTTTTGAAAATGCTCATATA
GCATATCTAAAATTTAAGGACACACCAATTAAATATCGTTGTGATCTACT
TTTAAAATTAGCCGATAAACTAGATGAACATAAACAAGAATTAGCACAAA
TTATTAGTACTGAAATTGCAAAAGGATTAAAAGATAGCCTAATTGAAGTT
GAACGAAGTGCTGATTATTTACGCGAAACAGTTTTTGAGTATCAAAAATT
AATGCAAAAACCAATTATTTTTGATGAAACAGTTCACCATGTTAAAAACA
AAGTGGCAACATATTATCGTATTCCAGTTGGTGTTGTTTTAGCAATTTGT
CCTTTTAATTATCCTATTAACTTATTGATTTCAAAATTAGCACCAGCATT
AGTTTCTGGTAATAGTTTAGTTTATAAACCATCAACACAAGGTTCATTAA
TTGGTATTCGAATTAGTGAATTAGTTCATGAAGTAGGTTTTCCAAAAGGA
GTTGTTAACTGCTTAACAACTGAAGCACGTATAACAGGTGATCTACTAGT
TACTAATAAATATGTTAAAGCGATTAGCTTTACGGGCGGACCTAAAGTAG
GCAATCATATTGCTGAAATAACATCAAAGATTTCTTTAGTTTTAGAATTA
GGAGGAAAAGATCCAGCCCTTGTTTTAGATGATGCGGATTTTGAACTAGC
TGCTAATGAAATAGTTAAAGGTGCTTATGGCTTTAGCGGGCAAAGATGTA
CTGCAATCAAACGAGTATTTGTTTCGCATAAAAATCATGATTTATTAGTT
AATTTAATTAACAAAAAAGTTGACGCTTTAACAGTCGGTTTACCACAACA
AAATCCCATAATTACTCCATTAATTAATTCTAATTCATTAAAATATAACT
TATCATTAGTTGAGGATGCAATCAAAAAAGGAGCAATAGTACACCAAAAA
ATCGTTTATAATGAAAAAAATAACCTTTTGCATCCTTTAGTAATTGATAA
TGTTACAAAAGAAATGCGCGTAGCTTGAGAAGAACCATTCGGTCCTATTT
TACCAATTATAACTTATAATAGTATACAAGAAGCTATTGATTTAATTAAT
CAATCACAATATGGTTTACAAGCTTGTATTTTTACAACAAATTATGCAAG
TATTGAACAATTAGCTTTACAAATTGAATCAGGAACAATTAACATTAATA
AATCAAGTTCACGTGGTCCAGATATTTTACCTTTTTTTGGTGTTAAAGAT
TCTGGATTTGGTGTTCAAGGTATTGTTGATGCAATTTTATCAATGACAAC
AATCAAAGGAATAATCATTAATAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy