Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR299 IGR298 IGR294 IGR297 IGR300 IGR296 IGR295 UU352 UU353 UU351 yaaC,ribF, - UU355 fhuG,fecD,fecC, - UU357 fatC, - UU358 rpoD, - UU349 UU359 UU356 UU352 UU353 UU351 yaaC,ribF, - UU355 fhuG,fecD,fecC, - UU357 fatC, - UU358 rpoD, - UU349 UU359 UU356 Type: tandem, Name:  - 227 Type: tandem, Name:  - 232 Type: tandem, Name:  - 226 Type: tandem, Name:  - 230 Type: tandem, Name:  - 224 Type: tandem, Name:  - 446 Type: tandem, Name:  - 231 Type: tandem, Name:  - 229 Type: tandem, Name:  - 225 Type: tandem, Name:  - 383 Type: tandem, Name:  - 228 UU352 UU353 UU351 yaaC,ribF, - UU355 fhuG,fecD,fecC, - UU357 fatC, - UU358 rpoD, - UU349 UU359 UU356 UU350 truB, - UU354 UU350 truB, - UU354
* Calculated from Protein Sequence

Gene ID: UU355

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yaaC  ribF  

Definition:
riboflavin kinase/ FAD synthetase

Gene Start:
402614

Gene Stop:
403465

Gene Length:
852

Molecular Weight*:
32755

pI*:
9.80

Net Charge*:
6.63

EC:
2.7.1.26  2.7.7.2  

Functional Class:
biosynthesis of cofactors, prosthetic groups, and carriers; riboflavin  

Pathway: pathway table
Riboflavin metabolism

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to riboflavin kinase sequences, e.g. residues 19-273 are 32% similar to RIBF_MYCGE. Residues 13-272 are 28% similar to RIBC_BACSU. UU355 is also similar to CT093, a predicted riboflavin kinase sequence. No similarity to T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0196 is ehgpc-yu.
Cog name: Predicted FAD synthase.
Functional class: H.
BeTs to -hg-c--u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Curiously, residues 158-189, 73-114 and 29-74 are similar to blocks BL00115B, S and W, concerned with eukaryotic RNA polymerases, e.g. RPBO_ARATH.

ProDom Summary:  Protein Domain Search
Residues 22-159 are 34% similar to a riboflavin kinase domain of RIBF_MYCPN.
Residues 169-278 are 40% similar to a domain of O66535_AQUAE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 18 to 151 (E-value = 1.2e-29) place UU355 in the Flavokinase family which is described as Riboflavin kinase (Flavokinase) (PF06574)
Residues 158 to 283 (E-value = 2e-23) place UU355 in the FAD_Synth family which is described as Riboflavin kinase / FAD synthetase (PF01687)

PDB Hit:


Gene Protein Sequence:
MIIEITSTNIYKIKQQFVINELIIGFFDGIHLGHMNLLSDPNNQTILTFK
NIPRKIKKLYDFNERIQQLEDLGFKRIFIYDIDQNNLSGEEFIDQILKPL
TPKKIIVGANFTYGNNFCNASSLKQYFNVEIKIITNDVSTTKIKELIINK
QVEIANKLLIKPYYRVGNVVRGDQIARNIGFNTANILCDNNLIDIAEGVY
KAQVIFNNKKYDSVVYLGIPKTINTRSFSMIEAHILDFNQNIYDERIKIV
FLKYLAPNLKFNNIDELITAIKNYIKLVLDKTN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTATTGAAATAACATCAACAAATATTTATAAAATTAAGCAACAATT
CGTCATTAATGAATTAATTATTGGTTTTTTTGATGGAATTCATTTAGGTC
ATATGAATTTATTATCAGATCCTAATAACCAAACTATTTTAACTTTTAAA
AATATCCCACGTAAAATAAAAAAATTATATGATTTTAATGAGCGAATTCA
ACAATTAGAAGATTTAGGATTTAAAAGGATTTTTATTTATGATATTGATC
AAAACAATTTAAGTGGGGAAGAATTTATTGATCAAATTTTAAAGCCACTA
ACTCCAAAAAAAATTATTGTTGGTGCTAATTTTACTTATGGCAATAATTT
TTGTAATGCATCTAGTCTAAAACAATATTTTAATGTTGAAATTAAAATTA
TTACTAATGATGTTAGTACAACTAAAATTAAAGAATTAATTATAAATAAA
CAGGTTGAAATAGCTAATAAATTATTAATTAAACCATATTATCGTGTGGG
AAATGTTGTACGTGGCGATCAAATAGCTCGTAATATTGGTTTTAATACTG
CTAATATTTTATGTGATAATAATTTAATTGATATTGCTGAAGGTGTTTAC
AAAGCACAAGTAATTTTTAATAATAAAAAGTATGATAGTGTAGTTTATTT
AGGAATCCCTAAAACAATTAATACTCGCTCTTTTTCAATGATTGAAGCAC
ATATTTTAGACTTTAATCAAAATATTTATGACGAAAGAATTAAGATTGTT
TTTTTGAAATATTTAGCTCCTAATTTAAAATTTAATAATATAGATGAATT
AATCACTGCAATTAAAAATTATATTAAATTGGTTCTTGATAAAACAAATT
AG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy