Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR299 IGR298 IGR294 IGR297 IGR293 IGR296 IGR295 UU352 UU353 UU351 yaaC,ribF, - UU355 fhuG,fecD,fecC, - UU357 fatC, - UU358 rpoD, - UU349 UU356 lon, - UU348 UU352 UU353 UU351 yaaC,ribF, - UU355 fhuG,fecD,fecC, - UU357 fatC, - UU358 rpoD, - UU349 UU356 lon, - UU348 Type: tandem, Name:  - 226 Type: tandem, Name:  - 231 Type: tandem, Name:  - 225 Type: tandem, Name:  - 229 Type: tandem, Name:  - 223 Type: tandem, Name:  - 446 Type: tandem, Name:  - 230 Type: tandem, Name:  - 228 Type: tandem, Name:  - 224 Type: tandem, Name:  - 383 Type: tandem, Name:  - 227 UU352 UU353 UU351 yaaC,ribF, - UU355 fhuG,fecD,fecC, - UU357 fatC, - UU358 rpoD, - UU349 UU356 lon, - UU348 UU350 truB, - UU354 UU350 truB, - UU354
* Calculated from Protein Sequence

Gene ID: UU354

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
truB  

Definition:
tRNA pseudouridine synthase B (tRNA pseudouridine 55 synthase)

Gene Start:
401965

Gene Stop:
402648

Gene Length:
684

Molecular Weight*:
25750

pI*:
10.50

Net Charge*:
12.71

EC:
4.2.1.70  

Functional Class:
translation; tRNA modification  

Pathway: pathway table
Pyrimidine metabolism

Comment:
See UU113, UU313, and UU536 for other pseudouridine synthases sequences in U.u.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to TRUB sequences, e.g. residues 18-216 are
37% similar to TRUB_BORBU and 34% similar to TRUB_MYCTU. Residues 18-216 are 31% similar to (AE001258) tRNA pseudouridine 55 synthase (truB) of Treponema pallidum.
UU354 is also similar to CT094 and TP0889, both predicted TRUB sequences. No similarity to M.genitalium.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0130 is eh---cmy.
Functional class: J.
BeTs to-h---cmy .
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 8-176 are 36% similar to a TRUB domain as seen in TRUB_MYCTU.
Weaker similarities to TRUB_METJA, O59721_SCHPO, TRUB_BORBU support
this association.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 24 to 177 (E-value = 2.2e-41) place UU354 in the TruB_N family which is described as TruB family pseudouridylate synthase (N terminal domain) (PF01509)

PDB Hit:


Gene Protein Sequence:
MSAISKNIIIINKPIKWTSNDVVQKVKRVIGAKKVGHAGTLDPNASGVLV
LGINEGTKLLTKLILDNKSYIAEIKFGTSTNTYDAAGEIVSSTNRMVTLT
EVTKIVKDFYKNDYWQKPPQFSALKINGQKAYVLARQKVDFEIAPRLVKI
FKYQIMDFNYEKQILKISLHVSKGFYVRSFAVDLATKINNLAHLLTLIRT
QSGPFEIKDAIEIEQVYDYWNNINKYL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGCTATTAGTAAAAATATTATTATCATTAACAAACCAATAAAATG
AACTTCTAATGATGTTGTTCAAAAGGTTAAACGGGTTATTGGTGCTAAAA
AAGTTGGACATGCTGGAACTTTAGATCCTAATGCTTCAGGTGTTTTAGTA
TTGGGAATTAATGAAGGAACAAAACTATTAACAAAATTAATACTAGATAA
TAAATCATATATTGCTGAAATTAAATTTGGAACATCAACAAATACTTATG
ATGCAGCAGGTGAAATTGTTTCATCTACAAACCGAATGGTTACATTAACT
GAGGTTACTAAAATAGTTAAAGATTTTTATAAAAATGATTATTGACAAAA
ACCCCCACAATTTAGCGCTTTAAAAATCAACGGGCAAAAAGCTTATGTTT
TAGCACGTCAAAAAGTTGATTTTGAAATAGCACCACGATTAGTTAAAATA
TTTAAATATCAAATTATGGATTTCAATTATGAAAAACAAATTTTAAAAAT
TTCTTTACATGTTTCTAAAGGTTTTTATGTTCGTTCTTTTGCTGTTGATT
TAGCTACTAAAATTAATAATCTAGCTCATTTATTGACATTAATAAGGACG
CAAAGTGGACCTTTTGAGATTAAAGATGCAATTGAAATTGAACAAGTCTA
TGATTATTGAAATAACATCAACAAATATTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy