Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR294 IGR293 IGR291 IGR290 IGR292 IGR295 UU352 UU353 UU351 plsC, - UU344 UU346 rpoD, - UU349 tig, - UU347 lon, - UU348 UU352 UU353 UU351 plsC, - UU344 UU346 rpoD, - UU349 tig, - UU347 lon, - UU348 Type: tandem, Name:  - 220 Type: tandem, Name:  - 225 Type: tandem, Name:  - 219 Type: tandem, Name:  - 223 Type: tandem, Name:  - 217 Type: tandem, Name:  - 224 Type: tandem, Name:  - 222 Type: tandem, Name:  - 218 Type: tandem, Name:  - 226 Type: tandem, Name:  - 221 UU352 UU353 UU351 UU346 rpoD, - UU349 tig, - UU347 lon, - UU348 UU350 UU345 UU350 UU345 plsC, - UU344
* Calculated from Protein Sequence

Gene ID: UU348

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lon  

Definition:
ATP-dependent protease LA (LON family)

Gene Start:
395023

Gene Stop:
397398

Gene Length:
2376

Molecular Weight*:
89521

pI*:
5.30

Net Charge*:
-18.32

EC:
3.4.21.53  

Functional Class:
translation; degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Comment:
A heat shock induced peptidase that typically degrades regulatory proteins.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to LON sequences, e.g. residues 4-791
are 41% similar to LON1_BACSU. UU348 is also similar to MG239, CT344
and TP0524, predicted LON proteases.



COGS Summary:  COGS Search
The phylogenetic pattern of COG0466 is ehgp--yu.
Cog name: ATP-dependent protease, ATPase domain.
Functional class: O.
BeTs to e--p--yu.
Number of proteins in this genome belonging to this COG is 1

See also COG for serine proteases.







Blocks Summary:  Blocks Search
Residues 227-252, 321-366, 367-410, 442-482 are similar to blocks
BL01046A-D, which encompass ATP-dependent proteases, e.g. LON_MYCPN.


ProDom Summary:  Protein Domain Search
Residues 179-291, 332-390, 391-592, 597-714, 720-788 are 36%, 71%, 63%, 61%, 62% similar to protease domains of LON_MYCGE
or LON-MYCPN. Residues 4-139 are 31% similar to a LON domain of LON_VIBPA.

Paralogs:  Local Blast Search
No paralogs in U.u., however UU348 is weakly related to UU391, a
predicted serine proteinase.

Pfam Summary:  Pfam Search
Residues 360 to 555 (E-value = 4.1e-45) place UU348 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)
Residues 582 to 790 (E-value = 2e-93) place UU348 in the Lon_C family which is described as Lon protease (S16) C-terminal proteolytic domain (PF05362)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
205
coil-coil  
212  
291

PDB Hit:


Gene Protein Sequence:
MKKPILISRAIVVLPYETTTIEVGRPKSIQAIDLAKQSSSKEIIIISQKD
IDTDEVVNFDELYKVGTLVKIKSIIDNFDEGYSIEVEGLKAVYINNENDV
IDAIEYEYEDVITNPILSNKDEIAINGINSEIFNIINKRSRHKNINFDNM
HALISLEKEKFAYLAAATYINDYDNEISEKTIEDRINILLQPNLLLVHET
ILHLLFDQLVDKRVIEDEVEKTITDKINNNFQKQQREFYLREKLKVVKEQ
LGELSSREEDADKIRAKIEDLELPPNVKERALAELNRFENAMSSNESSVI
KSYLDWLLDLPWTQQGVDNTDLMSVRTHLDDNHYGIEKVKERILEYLALR
MRNPNLKGPIICLVGPPGVGKTSLVTSIAQALNKKFVKVSLGGVRDESEI
RGHRKTYVGAMPGRIIKGMKKAGVINPLFLLDEIDKMTSDQRGDPAAAML
EVLDPEQNKNFSDNYIEEEYDLSKVMFMATANYYQQIPYALIDRLEVIEL
SSYTAIEKREIAKSHLLKRIFMDAKLNENELIFTDDALDFIINHYTKEAG
VRELDRQLGHIVRKYIVETYKNKNNQSPLNLKVDEAMIIKYLGKIKFDFN
KKEETTIPGIVNGMAYTAAGGDLLPIEVNHSTNGKGGNVTITGNLEKTMN
ESVSVALGFVKANADKYGIDTKKVSFKEIDIHVHVPSGGIPKDGPSAGIA
ITTAIISSLSQRPVRTTLSMTGEIMLRGNVGIIGGVKEKVISAYRAGVRE
IILPIDDERYLEDVPKYILDDIKIHLVKHYDEVYNIVFGEK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAACCTATCTTAATATCACGAGCAATTGTTGTTTTACCTTATGA
AACAACAACAATTGAAGTAGGACGCCCTAAATCAATCCAAGCGATTGATT
TAGCTAAACAATCTTCAAGTAAAGAAATTATTATTATTTCACAAAAAGAT
ATTGATACTGATGAAGTTGTTAATTTTGATGAATTGTATAAAGTAGGAAC
GTTAGTTAAAATTAAATCTATTATTGATAATTTTGATGAAGGTTATTCAA
TTGAAGTTGAAGGATTAAAAGCTGTTTACATTAATAATGAGAATGATGTT
ATTGATGCTATTGAATATGAATATGAAGATGTCATTACAAACCCTATTTT
ATCAAATAAAGATGAAATAGCAATCAATGGTATTAATTCTGAAATTTTCA
ATATAATTAACAAGCGTTCAAGACATAAAAATATCAATTTTGATAATATG
CACGCTTTAATTTCACTTGAAAAAGAAAAGTTTGCTTATTTAGCTGCGGC
AACTTATATTAATGATTATGATAATGAAATTAGTGAAAAAACTATTGAAG
ATCGAATTAATATCTTATTGCAACCTAATTTATTATTAGTTCATGAGACA
ATTTTACATTTATTATTTGATCAATTAGTAGATAAGCGCGTTATTGAAGA
TGAAGTTGAAAAAACTATTACTGATAAAATTAATAATAATTTTCAAAAAC
AACAACGTGAGTTCTATTTACGCGAAAAATTAAAAGTTGTTAAAGAACAA
TTAGGTGAACTAAGTAGTCGTGAAGAAGACGCTGATAAAATTCGTGCAAA
AATTGAAGATTTAGAATTACCACCAAATGTTAAAGAACGTGCTTTAGCTG
AATTAAATCGTTTTGAGAATGCTATGTCATCAAATGAATCATCAGTTATT
AAATCATATCTTGATTGATTATTGGATTTACCATGAACTCAACAGGGTGT
TGATAATACTGATTTGATGTCTGTAAGAACTCATTTAGATGATAATCACT
ATGGTATTGAAAAGGTAAAAGAAAGAATTTTAGAGTATTTAGCATTACGT
ATGCGTAACCCTAATCTTAAAGGTCCAATCATTTGTTTAGTTGGCCCTCC
AGGTGTTGGTAAAACATCACTTGTTACTTCGATTGCACAAGCTTTAAATA
AAAAATTTGTTAAAGTTAGTTTAGGTGGTGTGCGAGATGAATCTGAAATT
CGAGGTCATCGTAAAACTTATGTTGGAGCTATGCCCGGACGTATTATTAA
GGGTATGAAAAAGGCTGGCGTTATCAATCCTTTATTCCTATTAGATGAAA
TTGATAAAATGACATCTGATCAACGAGGAGATCCTGCTGCCGCAATGCTT
GAAGTATTAGATCCTGAACAAAATAAAAATTTTTCAGATAATTACATTGA
AGAAGAATATGATTTGAGCAAAGTGATGTTTATGGCAACAGCTAATTATT
ATCAACAAATTCCTTATGCTTTGATTGATCGTTTAGAAGTAATTGAACTA
TCGAGTTATACAGCAATTGAAAAACGTGAAATAGCAAAATCACATCTATT
AAAAAGAATTTTTATGGATGCTAAATTAAATGAAAATGAACTTATTTTTA
CTGATGATGCTTTAGATTTTATTATTAATCATTATACTAAAGAAGCTGGA
GTACGAGAATTAGATCGTCAATTAGGTCATATTGTACGCAAGTACATTGT
TGAAACTTATAAGAATAAAAATAATCAATCACCTTTGAATTTAAAAGTTG
ATGAAGCCATGATTATTAAATATTTAGGTAAAATTAAGTTTGATTTTAAT
AAAAAAGAAGAGACAACAATTCCAGGAATTGTTAATGGAATGGCTTATAC
AGCGGCTGGTGGCGATTTATTGCCTATTGAAGTTAATCATTCAACCAATG
GAAAAGGTGGAAATGTAACTATTACTGGAAATCTTGAAAAAACAATGAAT
GAATCTGTATCTGTTGCTTTAGGTTTTGTTAAAGCAAATGCAGATAAATA
TGGCATTGATACTAAAAAAGTTTCTTTTAAAGAAATTGATATTCATGTTC
ATGTTCCAAGCGGAGGAATTCCTAAAGATGGACCGTCTGCTGGAATTGCG
ATTACAACAGCAATTATTAGTTCATTAAGTCAAAGACCAGTGCGTACAAC
ACTATCAATGACAGGAGAAATTATGCTACGTGGTAATGTTGGAATTATTG
GTGGTGTTAAAGAAAAAGTTATTTCAGCATATCGTGCTGGAGTTCGTGAA
ATTATTTTACCAATTGATGACGAACGTTACTTAGAAGATGTTCCAAAGTA
TATATTAGATGATATTAAAATTCATTTGGTAAAACACTATGATGAAGTTT
ATAATATTGTTTTTGGAGAAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy