Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR287 IGR289 IGR286 IGR288 IGR291 IGR290 IGR292 UU343 UU341 cmk, - UU342 plsC, - UU344 UU346 UU340 tig, - UU347 dnaK, - UU339 lon, - UU348 UU343 UU341 cmk, - UU342 plsC, - UU344 UU346 UU340 tig, - UU347 dnaK, - UU339 lon, - UU348 Type: tandem, Name:  - 219 Type: tandem, Name:  - 216 Type: tandem, Name:  - 221 Type: tandem, Name:  - 217 Type: tandem, Name:  - 218 Type: tandem, Name:  - 220 Type: tandem, Name:  - 222 UU343 UU341 cmk, - UU342 plsC, - UU344 UU346 UU340 tig, - UU347 dnaK, - UU339 lon, - UU348 UU345 UU345
* Calculated from Protein Sequence

Gene ID: UU344

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
plsC  

Definition:
1-acyl-sn-glycerol-3-phosphate acyltransferase

Gene Start:
390535

Gene Stop:
391329

Gene Length:
795

Molecular Weight*:
30673

pI*:
10.60

Net Charge*:
16.20

EC:
2.3.1.51  

Functional Class:
fatty acid and phospholipid metabolism; biosynthesis  

Pathway: pathway table
Glycerolipid metabolism

Comment:
See UU206, a predicted plsX sequence.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to probable 1-acyl-sn-glycerol-3-phosphate acyltransferases, e.g. residues 3-253 are 32% similar to PLSC_MYCGE (MG212). Apart from the similarities to mycoplasma proteins, BLAST scores are below 100 due to the lack of similarity over the NH-terminal residues. No significant similarity to T.pallidum or C.trachomatis.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0204 is ehgpc-yu.
Cog name: 1-acyl-sn-glycerol-3-phosphate acyltransferase.
Functional class: I.
BeTs to -h-p--yu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 53-193 are 42% similar to an acyltransferase domain as seen in PLSC_MYCPN.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 64 to 194 (E-value = 1.9e-28) place UU344 in the Acyltransferase family which is described as Acyltransferase (PF01553)

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
27

PDB Hit:


Gene Protein Sequence:
MNFLKTLLWFVAYPFVALYIIIQMILAAMMANKYKNDPESVSVNERYKKI
MGIIDAILYLKNIKVDLIGKENVSIKSMLYIGNHKSNGDPIVLLKALYQI
SPHNVRFVAKIELKKSFLKFLFNLIDVIYIDRNNLRQSISTINEQVNALK
QDYRGLVIFPEGTRNFNHEFNEFKSGALTAAYNTLSSIQPFVIFNSQGSF
EMKNDQKQKLRSNPFKTQHIKVSFLEPIHSFNYININKDILMRKIQSNIK
KNYDELLKSTIKTN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATTTTTTAAAAACCTTACTGTGATTTGTTGCATATCCTTTTGTAGC
ATTATACATAATAATTCAAATGATTTTAGCGGCTATGATGGCAAATAAAT
ATAAAAATGATCCAGAGTCTGTTAGCGTTAATGAGCGCTATAAAAAAATA
ATGGGTATTATTGATGCTATTTTATATTTAAAAAATATTAAAGTAGATTT
GATTGGTAAAGAAAATGTTAGTATAAAAAGCATGTTATACATAGGTAATC
ACAAATCTAATGGTGATCCAATTGTTTTATTAAAGGCTCTTTATCAAATT
AGCCCTCATAATGTGCGTTTTGTTGCTAAAATTGAATTAAAAAAATCATT
TTTAAAATTTTTATTTAATTTAATTGATGTAATTTACATTGACCGTAATA
ATTTAAGACAATCAATTTCAACAATTAATGAACAAGTTAATGCTTTAAAA
CAAGATTATCGTGGATTAGTTATTTTTCCAGAAGGAACACGAAATTTTAA
TCATGAATTTAATGAGTTTAAATCAGGCGCTTTAACAGCTGCTTATAATA
CATTATCTTCGATTCAACCTTTTGTGATTTTTAACTCACAAGGTTCGTTT
GAAATGAAAAACGATCAAAAGCAAAAGTTAAGATCAAATCCTTTTAAAAC
CCAACATATTAAAGTTAGTTTTTTAGAACCAATTCATTCTTTTAATTACA
TTAATATTAATAAAGATATTTTAATGCGTAAGATTCAATCAAACATTAAA
AAAAATTATGATGAATTGTTAAAATCAACAATTAAAACAAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy