Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR287 IGR289 IGR286 IGR288 IGR291 IGR290 IGR285 UU343 UU341 cmk, - UU342 plsC, - UU344 UU346 UU340 tig, - UU347 dnaK, - UU339 UU338 UU343 UU341 cmk, - UU342 plsC, - UU344 UU346 UU340 tig, - UU347 dnaK, - UU339 UU338 Type: tandem, Name:  - 219 Type: tandem, Name:  - 216 Type: tandem, Name:  - 221 Type: tandem, Name:  - 217 Type: tandem, Name:  - 218 Type: tandem, Name:  - 220 Type: tandem, Name:  - 222 UU343 UU341 cmk, - UU342 plsC, - UU344 UU346 UU340 tig, - UU347 dnaK, - UU339 UU338 UU345 UU345
* Calculated from Protein Sequence

Gene ID: UU342

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cmk  

Definition:
cytidylate kinase

Gene Start:
389445

Gene Stop:
390119

Gene Length:
675

Molecular Weight*:
25604

pI*:
9.40

Net Charge*:
4.39

EC:
2.7.4.14  

Functional Class:
purines, pyrimidines, nucleosides, and nucleotides; pyrimidines  

Pathway: pathway table
Pyrimidine metabolism

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to cytidylate kinase sequences, e.g. residues 7-209 are 37% similar to KCY_MYCGE. UU342 is also similar to CT452 and TP0279.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0283 is eHgpc---.
Cog name: Cytidylate kinase.
Functional class: F.
BeTs to -h-pc---.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 4-21 are similar to block PR00988A, concerned with uridine kinase signatures. Residues 76-113 are similar to block PF00774G, concerned with dihydropyridine sensitivity.

ProDom Summary:  Protein Domain Search
Residues 76-214 are 41% similar to a cmk domain of P74087_XXXXX.
Residues 7-57 are 49% similar to a cmk domain of KCY_BACSU.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 61 to 213 (E-value = 5.6e-43) place UU342 in the Cytidylate_kin family which is described as Cytidylate kinase (PF02224)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
138

PDB Hit:
gi|6137471|pdb|2CMK|A Chain A, Cytidine Monophosphate Kinase In Complex With Cytidine-Di- Phosphate

Gene Protein Sequence:
MKKYISIAIDGPSGSGKSTAAKELAKKLGFLYINTGLMYRAYAYFLSINK
LDINVNEMDCINAIKNANFIFNGDNVKINDNDVSLILRSNDVAMIASVVS
ANEKIRDLATNEQRRIASENNVVMDGRDIGSIVLTNADLKFYLNTSIQTR
AKRRLFQNKDIENLDYESIYNDIKERDHRDMTRKIAPLKKANDAVEIFND
NMKLDECVQHLYEIYLKKIKKLNF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAATATATCAGTATCGCTATTGATGGACCTTCAGGTTCTGGAAA
AAGTACAGCAGCAAAAGAATTAGCCAAGAAATTGGGATTTTTATATATTA
ACACTGGTTTAATGTATCGTGCTTATGCTTATTTTTTATCTATTAATAAA
TTAGATATTAATGTTAACGAAATGGATTGTATTAATGCCATTAAAAATGC
TAATTTTATTTTTAATGGTGATAATGTGAAAATTAATGACAACGATGTTA
GTCTTATCTTAAGAAGTAATGATGTGGCAATGATTGCTAGTGTTGTATCT
GCTAATGAAAAAATTCGAGATTTAGCAACTAATGAACAACGCAGAATTGC
TAGTGAAAACAACGTTGTTATGGATGGGCGCGATATTGGAAGTATTGTTT
TAACTAATGCTGATCTTAAATTTTATTTAAATACGAGCATTCAAACACGC
GCTAAACGACGTTTGTTTCAGAATAAAGATATTGAAAATTTGGATTATGA
ATCAATATATAACGATATTAAAGAACGTGATCATCGTGATATGACTCGCA
AAATTGCTCCACTTAAAAAAGCAAACGATGCTGTTGAAATTTTTAACGAT
AACATGAAATTAGATGAATGTGTACAACATTTGTATGAAATTTATTTAAA
AAAAATAAAAAAGCTAAATTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy