Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR280 IGR282 IGR286 IGR283 IGR284 IGR281 IGR285 IGR279 urk,udk, - UU332 rpL32, - UU333 UU334 folD, - UU337 UU340 UU336 dnaK, - UU339 UU338 UU335 urk,udk, - UU332 rpL32, - UU333 UU334 folD, - UU337 UU340 UU336 dnaK, - UU339 UU338 UU335 Type: tandem, Name:  - 208 Type: tandem, Name:  - 213 Type: tandem, Name:  - 413 Type: tandem, Name:  - 207 Type: tandem, Name:  - 211 Type: tandem, Name:  - 433 Type: tandem, Name:  - 205 Type: tandem, Name:  - 215 Type: tandem, Name:  - 212 Type: tandem, Name:  - 210 Type: tandem, Name:  - 206 Type: tandem, Name:  - 214 Type: tandem, Name:  - 209 urk,udk, - UU332 UU334 folD, - UU337 UU340 UU336 dnaK, - UU339 UU338 UU335 rpL32, - UU333
* Calculated from Protein Sequence

Gene ID: UU337

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
folD  

Definition:
methylenetetrahydrofolate dehydrogenase

Gene Start:
382856

Gene Stop:
383665

Gene Length:
810

Molecular Weight*:
31594

pI*:
10.30

Net Charge*:
15.53

EC:
1.5.1.15  1.5.1.5  3.5.4.9  

Functional Class:
biosynthesis of cofactors, prosthetic groups, and carriers; folate  

Pathway: pathway table
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate

Comment:
High A+T content at 5' end of cds.

See Prosite PDOC00616.

From Prosite:

Enzymes that participate in the transfer of one-carbon units are involved in various biosynthetic pathways. In many of these processes the transfers of one-carbon units are mediated by the coenzyme tetrahydrofolate (THF). Various reactions generate one-carbon derivatives of THF which can be interconverted between different oxidation states by formyltetrahydrofolate synthetase (EC 6.3.4.3), methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5 or EC 1.5.1.15) and methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9).

The dehydrogenase and cyclohydrolase activities are expressed by a variety of multifunctional enzymes:

[...] FolD is an homodimeric bifunctional NADP-dependent enzyme of about 290 amino acid residues.

Blast Summary:  PSI-Blast Search
Several weak hits in gapped BLAST to methylenetetrahydrofolate dehydrogenases, e.g. residues 41-269 are 24% similar to FOLD_BACSU. UU337 is also weakly similar to MG013, CT078 and TP0732, all predicted FOLD proteins.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0190 is ehgpc-Yu.
Cog name: 5,10-methylene-tetrahydrofolate dehydrogenase.
Functional class: H.
BeTs to -hg-c-yu.
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 131-178, 196-225, 231-267 and 229-265 are similar to blocks
BL00766C-E, which encompass tetrahydrofolate dehydrogenase sequences,
e.g. FOLD_ECOLI.


ProDom Summary:  Protein Domain Search
Residues 39-266 are 27% similar to a FOLD domain of C1TM_YEAST.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 104 to 268 (E-value = 1.4e-09) place UU337 in the THF_DHG_CYH_C family which is described as Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain (PF02882)

PDB Hit:
gi|5542052|pdb|1B0A|A Chain A, 5,10, Methylene-Tetrahydropholate DehydrogenaseCYCLOHYDROLASE FROM E COLI.

Gene Protein Sequence:
MKLKIDFLYEKVLTELLTKKNKTKKRIYVFYDSDLVNFNSAYIQSKLKYA
KLFSVKLIIYDLNAYQIQENHHFLSKLKQANKDFLFFEFPLSKKHLDQNY
FQYLTFQNDLDGINSHLFLNKKQENQIIYHPATINAILTLIKELDVNLND
YRICIIGRSPYLGDYLYKLLNPKNNKINIIHSQTKNPLRIIKESNFIISC
VNKAHIFNSNALSDNSYLIDVTTEYINNKLCGSFLINKNDALNRNIKYTP
VPGGIGKLTTLFLFLNYFK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACTAAAAATTGATTTTTTATACGAAAAAGTCTTAACAGAATTATT
AACTAAAAAAAACAAAACTAAAAAACGTATTTATGTTTTTTATGATTCAG
ATTTAGTAAATTTTAATAGTGCATATATTCAATCAAAATTAAAATATGCT
AAATTATTTTCTGTTAAACTTATTATTTATGATTTAAATGCATACCAAAT
TCAAGAAAATCATCATTTTTTATCAAAACTTAAACAAGCAAATAAGGATT
TTTTGTTTTTTGAATTCCCTTTGTCAAAAAAACATTTGGATCAAAATTAT
TTTCAATATTTAACTTTTCAAAATGATCTCGATGGAATTAATTCACATTT
GTTTTTAAATAAAAAACAAGAAAATCAAATTATTTACCATCCAGCAACAA
TTAATGCAATTTTAACATTAATTAAAGAATTaGATGTAAATTTAAATGAC
TATCGAATTTGCATTATTGGTCGTTCACCCTATTTAGGGGATTATTTATa
TAAGTTATTAAATCCTAAAAATAATAAAATTAATATTATTCATTCACAAA
CTAAAAATCCATTAAGAATTATTAAAGAATCTAATTTTATTATTAGCTGT
GTGAATAAAGCACACATTTTTAATTCTAATGCATTAAGTGATAATTCTTA
TTTAATTGATGTTACTACAGAATACATCAATAATAAGTTATGTGGTTCTT
TTTTAATTAATAAAAATGATGCATTAAATCGAAACATTAAATACACTCCT
GTACCAGGTGGAATCGGTAAATTAACGACGTTATTTTTATTTTTGAATTA
TTTTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy