Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR280 IGR282 IGR278 IGR283 IGR281 IGR275 IGR279 IGR277 UU331 urk,udk, - UU332 rpL32, - UU333 UU334 folD, - UU337 UU328 UU330 UU329 UU336 UU335 UU331 urk,udk, - UU332 rpL32, - UU333 UU334 folD, - UU337 UU328 UU330 UU329 UU336 UU335 Type: tandem, Name:  - 201 Type: tandem, Name:  - 206 Type: tandem, Name:  - 433 Type: tandem, Name:  - 200 Type: tandem, Name:  - 204 Type: tandem, Name:  - 211 Type: tandem, Name:  - 210 Type: tandem, Name:  - 208 Type: tandem, Name:  - 205 Type: tandem, Name:  - 199 Type: tandem, Name:  - 202 Type: tandem, Name:  - 209 Type: tandem, Name:  - 212 Type: tandem, Name:  - 413 Type: tandem, Name:  - 198 Type: tandem, Name:  - 213 Type: tandem, Name:  - 203 Type: tandem, Name:  - 207 UU331 urk,udk, - UU332 UU334 folD, - UU337 UU328 UU330 UU329 UU336 UU335 spoU, - UU327 spoU, - UU327 rpL32, - UU333
* Calculated from Protein Sequence

Gene ID: UU332

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
urk  udk  

Definition:
uridine kinase

Gene Start:
378714

Gene Stop:
378091

Gene Length:
624

Molecular Weight*:
24162

pI*:
9.10

Net Charge*:
4.11

EC:
2.7.1.48  

Functional Class:
purines, pyrimidines, nucleosides, and nucleotides; salvage of nucleosides and nucleotides  

Pathway: pathway table
Pyrimidine metabolism

Comment:


Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to uridine kinase sequences, e.g. residues 4-206 are 41% similar to the enzyme from B.subtilis (Z99117). UU332 is similar to MG382 and, weakly, to TP0667, two predicted uridine kinases. No similarity to C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0572 is EHgpc-Y-.
Cog name: Uridine kinase/panthothenate kinase.
Functional class: F/H.
BeTs to -hg-c-y-.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 6-187 span six regions of similarity to blocks PR00988A-F, which encompass uridine kinase signatures, e.g. URK_BORBU.



ProDom Summary:  Protein Domain Search
Residues 8-126 are 37% similar to a uridine kinase domain as seen in URK_MYCGE. Residues 131-199 are 52% similar to a udk domain of URK_ECOLI.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 8 to 195 (E-value = 2.3e-34) place UU332 in the PRK family which is described as Phosphoribulokinase / Uridine kinase family (PF00485)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
73  
151

PDB Hit:


Gene Protein Sequence:
MNTKSPILILIAGASGSGKTTFANEIIARIPKNTTSVVICQDSYYISNSQ
LNKKERRLINYDHPSSFEWELMREQLSDIKKRKKIKVPIYDYKTEIRLDK
TIDISDVDVIVLEGIYAIYDDVINQIADLKIFIETPKDECLIRRILRDVN
ERNRSFESVITQWRSTVSPMYDQFVEPSKKNANVSVLWNEHNRVALHLIH
KWINNIH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATACTAAATCCCCAATTCTTATACTAATTGCAGGAGCTTCTGGTTC
TGGAAAAACAACCTTTGCTAATGAAATTATTGCAAGAATTCCTAAAAATA
CAACAAGTGTTGTTATTTGTCAAGATTCTTACTATATTTCTAATTCACAA
CTAAATAAAAAAGAACGCCGCTTAATTAATTATGATCATCCAAGTAGTTT
TGAATGAGAGTTAATGCGAGAGCAATTAAGTGACATTAAAAAACGTAAAA
AAATTAAAGTACCAATCTATGATTATAAAACTGAGATTCGTTTAGATAAA
ACGATTGATATTAGTGATGTTGATGTTATAGTTCTTGAAGGTATTTATGC
AATTTATGATGATGTCATTAATCAAATAGCTGATTTGAAAATTTTTATTG
AAACTCCAAAAGATGAATGTTTAATTCGACGAATTCTTCGAGATGTTAAT
GAACGTAATCGATCATTTGAATCTGTAATTACTCAATGACGTAGCACTGT
TAGCCCTATGTATGATCAATTTGTTGAACCAAGTAAGAAGAATGCTAATG
TTAGTGTGCTATGAAATGAACACAATCGTGTTGCATTACATTTAATTCAT
AAATGAATAAATAATATACATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy