Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR263 IGR261 IGR264 IGR265 IGR260 IGR262 rpS20, - UU310 ard1, - UU311 ppa, - UU315 UU314 rluD, - UU313 UU308 UU316 UU309 UU317 rpS20, - UU310 ard1, - UU311 ppa, - UU315 UU314 rluD, - UU313 UU308 UU316 UU309 UU317 Type: tandem, Name:  - 190 Type: tandem, Name:  - 187 Type: tandem, Name:  - 192 Type: tandem, Name:  - 188 Type: tandem, Name:  - 189 Type: tandem, Name:  - 191 Type: tandem, Name:  - 411 rpS20, - UU310 ard1, - UU311 ppa, - UU315 UU314 rluD, - UU313 UU308 UU312 UU312 UU316 UU309 UU317
* Calculated from Protein Sequence

Gene ID: UU315

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ppa  

Definition:
inorganic pyrophosphatase

Gene Start:
359160

Gene Stop:
358615

Gene Length:
546

Molecular Weight*:
21296

pI*:
5.70

Net Charge*:
-3.84

EC:
3.6.1.1  

Functional Class:
central intermediary metabolism; phosphorus compounds  

Pathway: pathway table
Oxidative phosphorylation

Comment:


Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to inorganic pyrophosphatase sequences, e.g. residues 3-181 are 59% similar to IPYR_MYCPN. Residues 5-160 are 43% similar to IPYR_THEAC. UU315 is also similar to CT772, a predicted PPASE. No similarity to T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0221 is ehgpc-Yu.
Cog name: Inorganic pyrophosphatase.
Functional class: C.
BeTs to e--pc-y-.
Number of proteins in this genome belonging to this COG is 1.



Blocks Summary:  Blocks Search
Residues 3-17, 20-57, 34-64, 69-99, 100-132 correspond to blocks BL00387A-D, which cover inorganic pyrophosphatase sequences, e.g. IPYR_MYCGE, IPYR_HELPY.

ProDom Summary:  Protein Domain Search
Residues 4-161 are 60% similar to a pyrophosphatase domain as observed in IPYR_MYCGE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 4 to 158 (E-value = 9e-40) place UU315 in the Pyrophosphatase family which is described as Inorganic pyrophosphatase (PF00719)

PDB Hit:
gi|1311189|pdb|2PRD| Mol_id: 1; Molecule: Pyrophosphate Phosphohydrolase; Chain: Null; Ec: 3.6.1.1

Gene Protein Sequence:
MKLNVTIEIPKNSNIKYEYDRATKEIMVDRILHGSMVYPHNYGFLKEALD
YDGDELDVLVFADQAFQPGIKVPARVLGAMKMIDGGETDTKLLAVIDVDP
RYKHINNFKDIPLHWLAEVQDFFENYKNLQNKKVKILGFEDEIWAQKEYE
ECVLLMKEYGHLKKDEFVTKMMKERPEKYIK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTAAATGTAACTATTGAAATTCCAAAGAACTCAAATATTAAATA
TGAATATGATCGTGCAACTAAAGAAATCATGGTTGATCGTATCTTACACG
GTTCAATGGTTTATCCTCATAATTATGGTTTTTTAAAAGAAGCATTAGAT
TATGATGGTGACGAATTGGATGTTTTGGTTTTTGCTGATCAAGCATTCCA
ACCAGGAATTAAAGTACCTGCACGTGTTTTGGGCGCCATGAAAATGATTG
ATGGAGGAGAAACAGATACTAAATTATTGGCAGTTATTGATGTTGATCCT
CGTTATAAACACATTAATAATTTCAAAGATATTCCATTACATTGATTAGC
AGAAGTGCAAGATTTCTTTGAAAATTACAAAAACTTACAAAATAAAAAAG
TTAAAATCTTGGGGTTTGAAGATGAAATATGAGCTCAAAAAGAATATGAA
GAATGTGTTCTTTTAATGAAAGAATATGGCCATCTTAAAAAAGATGAATT
TGTAACTAAAATGATGAAAGAACGTCCAGAAAAGTACATTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy