Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR240 IGR244 IGR243 IGR242 IGR241 IGR245 bsaA, - UU291 UU290 UU288 pmsR, - UU289 hisS, - UU285 aspS, - UU286 UU292 bsaA, - UU291 UU290 UU288 pmsR, - UU289 hisS, - UU285 aspS, - UU286 UU292 Type: tandem, Name:  - 171 bsaA, - UU291 UU290 pmsR, - UU289 hisS, - UU285 aspS, - UU286 UU292 UU287 UU288 UU287
* Calculated from Protein Sequence

Gene ID: UU291

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
bsaA  

Definition:
glutathione peroxidase

Gene Start:
327160

Gene Stop:
326672

Gene Length:
489

Molecular Weight*:
19290

pI*:
9.50

Net Charge*:
5.81

EC:
1.11.1.9  

Functional Class:
cellular processes; detoxification  
transport and binding proteins; other  

Pathway: pathway table
Glutathione metabolism

Comment:
Notice high A+T content at begininning of nucleotide sequence, and poor correspondence to beginning of protein sequences in PSI-BLAST.

See Prosite PDOC00396.

From Prosite:

Glutathione peroxidase is an enzyme that catalyzes the reduction of hydroxyperoxides by glutathione. Its main function is to protect against the damaging effect of endogenously formed hydroxyperoxides.

Notice BLAST summary indicating similarity to vitamin b12 transport periplasmic protein btuE. This sequence may be involved in transport.

Blast Summary:  PSI-Blast Search
Numerous hits in PSI-BLAST to glutathione peroxidases and their homologs; e.g. residues 37-158 are 39% similar to BSAA_BACSU, and residues 37-162 are 39% similar to GSHI_YEAST. Similar correspondence to GSHZ_CITSI, GSHY_HELAN, and GSHH_HUMAN.
No significant similarity to C.trachomatis, M.genitalium, or T.pallidum.

Residues 13-153 are 38% similar to residues 10-170 of vitamin b12 transport periplasmic protein btuE of E.coli. Residues 7-153 are 33% similar to (AB010691), a vitamine B12 transporter protein/glutathione peroxidase of Synechococcus sp.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0386 is e---C-Y-.
Cog name: Glutathione peroxidase.
Functional class: H.
BeTs to e---c-y-.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 18-146 span five regions of similarity to blocks BL00460A-D (Glutathione peroxidases selenocysteine proteins.)

ProDom Summary:  Protein Domain Search
Residues 40-97 are 56% similar to a defined domain of GSHH_YEAST, and residues 101-158 are 40% similar to BSAA_BACSU.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 10 to 115 (E-value = 2.9e-39) place UU291 in the GSHPx family which is described as Glutathione peroxidase (PF00255)

PDB Hit:
gi|229946|pdb|1GP1|A Chain A, Glutathione Peroxidase (E.C.1.11.1.9)

Gene Protein Sequence:
MERLNMKLSDYPVLDIDKKLFNWSKVKNKLVLIVNVASKCGYAKQYEQLE
YLYKKYKNKGFIIVAFPCRQFMFQEFDDNNKIKEFCSTKYNVTFPIMDLT
NVVGSNISPLYKQLITEYPWSPKAKAVKWNFEKFFVKNDEIIGRFESKCE
PNDLEEFIKNNL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAGGCTAAATATGAAATTAAGTGATTATCCGGTCTTAGATATCGA
TAAAAAATTGTTTAATTGATCAAAAGTTAAGAATAAACTAGTCTTAATTG
TTAATGTAGCAAGTAAATGTGGATACGCTAAACAATATGAACAATTAGAA
TATTTATACAAAAAATATAAGAATAAAGGATTCATCATTGTCGCTTTTCC
TTGCCGTCAATTTATGTTTCAAGAATTTGATGACAATAATAAAATAAAGG
AATTTTGTTCAACAAAATACAATGTTACTTTTCCAATAATGGATCTAACT
AATGTTGTAGGTTCTAATATTTCTCCATTATACAAACAATTAATTACTGA
GTATCCATGAAGTCCAAAAGCAAAAGCAGTAAAATGAAATTTTGAGAAAT
TTTTTGTTAAAAATGATGAAATTATTGGACGTTTTGAATCAAAATGTGAA
CCAAATGATTTAGAAGAATTTATTAAAAATAATTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy