Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR239 IGR240 IGR244 IGR243 IGR242 IGR241 IGR245 bsaA, - UU291 UU290 UU288 pmsR, - UU289 hisS, - UU285 pyrG, - UU284 aspS, - UU286 UU292 bsaA, - UU291 UU290 UU288 pmsR, - UU289 hisS, - UU285 pyrG, - UU284 aspS, - UU286 UU292 Type: tandem, Name:  - 170 Type: tandem, Name:  - 171 bsaA, - UU291 UU290 pmsR, - UU289 hisS, - UU285 pyrG, - UU284 aspS, - UU286 UU292 UU287 UU288 UU287
* Calculated from Protein Sequence

Gene ID: UU288

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
325346

Gene Stop:
325501

Gene Length:
156

Molecular Weight*:
6098

pI*:
5.60

Net Charge*:
-1.54

EC:
 

Functional Class:
unknown; hypothetical protein  

Pathway: pathway table

Comment:
Notice high A+T content of sequence.

Blast Summary:  PSI-Blast Search
No significant hits using gapped BLAST.

No significant similarity to C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, or T. pallidum.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MTVAYHNLDINDPKNVLLATQKFFNHINEIIIDYGLDKRDQWIKKIIPFE
E$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGTTGCATATCATAATTTAGATATTAATGACCCTAAAAATGTTCT
TTTAGCAACGCAAAAATTCTTTAATCATATTAATGAAATAATTATTGATT
ATGGTTTAGATAAACGTGATCAATGAATTAAAAAAATTATTCCTTTTGAA
GAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy