Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR239 IGR240 IGR244 IGR243 IGR242 IGR241 IGR245 bsaA, - UU291 UU290 UU288 pmsR, - UU289 hisS, - UU285 aspS, - UU286 spoT,relA, - UU283 UU292 bsaA, - UU291 UU290 UU288 pmsR, - UU289 hisS, - UU285 aspS, - UU286 spoT,relA, - UU283 UU292 Type: tandem, Name:  - 170 Type: tandem, Name:  - 171 bsaA, - UU291 UU290 pmsR, - UU289 hisS, - UU285 aspS, - UU286 UU292 UU287 pyrG, - UU284 pyrG, - UU284 spoT,relA, - UU283 UU288 UU287
* Calculated from Protein Sequence

Gene ID: UU287

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein (possible tRNA synthetase related)

Gene Start:
324664

Gene Stop:
325269

Gene Length:
606

Molecular Weight*:
23857

pI*:
8.40

Net Charge*:
2.87

EC:
 

Functional Class:
unknown; hypothetical protein  

Pathway: pathway table

Comment:
Notice high A+T content of sequence.

See UU192, UU457, and UU458 for other predicted phenlyalanyl-tRNA related sequences.

The complete list of predicted and possible tRNA synthetases is: UU062, UU106, UU117, UU123, UU175, UU192, UU197, UU267, UU278, UU285, UU286, UU287, UU365, UU369, UU371, UU410, UU452, UU457, UU458, UU493, UU534, and UU599.

Blast Summary:  PSI-Blast Search
No significant hits using gapped BLAST.

UU287 shows weak similarity to MG195, a phenylalanyl-tRNA synthetase beta chain from Mycoplasma genitalium: residues 18-163 of UU287 are 25% similar to residues 458-590 of MG195. No significant similarity to C. trachomatis, C. pneumoniae, M. pneumoniae, or T. pallidum.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
Residues 6-19 resemble block PR00731A (cauliflower mosaic virus peptidase (A3) signature.)

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralog in U.u.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
161  
186

PDB Hit:


Gene Protein Sequence:
MINKKIKINPNITYFKQKISNYHEHLLVWNDLYDKLISLTNNIIVDKNNK
NIYHQNDKQIFDFTLCLSGLLSKTLGLNHKSSSLYLTNDDEVAHRFKIKV
LHNYFNLYNIEEFFTFMDNQIPLENAKNIARLSLIYDLKQHENILKTISN
EGLENIDLEFAFINFLRAKISINFAYSYDISEVILLLRTGLDLHFFRKWA
F$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAATAAAAAGATAAAGATTAACCCAAATATAACATATTTTAAACA
AAAAATTTCTAATTATCATGAGCATTTGTTAGTTTGAAATGATTTATATG
ATAAATTAATTTCATTGACTAATAATATTATTGTTGATAAAAATAACAAA
AATATTTATCATCAAAACGACAAACAAATTTTTGATTTTACTTTATGTTT
ATCTGGTCTTTTGTCTAAAACTTTAGGTTTAAATCATAAATCATCTTCGC
TTTATTTAACAAATGATGATGAAGTAGCGCATCGTTTTAAGATTAAAGTT
TTGCATAATTATTTTAATTTATATAATATTGAAGAATTTTTTACGTTTAT
GGATAATCAAATTCCTTTAGAAAATGCAAAAAATATTGCACGTTTAAGTT
TAATTTATGATTTAAAACAACATGAAAATATTTTAAAAACTATATCGAAT
GAAGGTTTAGAAAATATTGATTTAGAATTTGCTTTCATTAATTTTTTAAG
AGCAAAAATCTCTATTAATTTTGCCTATAGTTATGATATTTCTGAAGTAA
TTTTATTGTTGCGAACAGGGCTAGATTTACATTTTTTTAGAAAATGAGCA
TTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy