Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR239 IGR240 IGR244 IGR243 IGR242 IGR241 IGR245 bsaA, - UU291 UU290 UU288 pmsR, - UU289 hisS, - UU285 aspS, - UU286 spoT,relA, - UU283 UU292 bsaA, - UU291 UU290 UU288 pmsR, - UU289 hisS, - UU285 aspS, - UU286 spoT,relA, - UU283 UU292 Type: tandem, Name:  - 169 Type: tandem, Name:  - 170 Type: tandem, Name:  - 171 bsaA, - UU291 UU290 pmsR, - UU289 hisS, - UU285 aspS, - UU286 spoT,relA, - UU283 UU292 UU287 pyrG, - UU284 pyrG, - UU284 UU288 UU287
* Calculated from Protein Sequence

Gene ID: UU286

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aspS  

Definition:
aspartyl-tRNA synthetase

Gene Start:
322935

Gene Stop:
324671

Gene Length:
1737

Molecular Weight*:
66998

pI*:
7.50

Net Charge*:
1.36

EC:
6.1.1.12  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Alanine and Aspartate metabolism
Aminoacyl-tRNA biosynthesis

Comment:
Reaction:
ATP + L-ASPARTATE + TRNA(ASP) = AMP + PYROPHOSPHATE + L-ASPARTYL-TRNA(ASP).

This protein may have an extra N-terminal region.

See Prosite PDOC00363.

The complete list of predicted and possible tRNA synthetases is: UU062, UU106, UU117, UU123, UU175, UU192, UU197, UU267, UU278, UU285, UU286, UU287, UU365, UU369, UU371, UU410, UU452, UU457, UU458, UU493, UU534, and UU599.

Blast Summary:  PSI-Blast Search
Numerous significant hits to aspartyl-tRNA synthetase sequences; e.g. residues 4-576 are 42% similar to SYD_BACSU, and residues 4-575 are 42% similar to SYD_THETH. Similar correlations occur to SYD_HELPY, SYD_ECOLE, SYDM_YEAST, SYD_HUMAN, and SYD_RAT.
BLAST also reveals similarity to CT542, TP0985, and MG036, all of which are aspartyl-tRNA synthetases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0173 is ehgpc-yu.
Cog name: Aspartyl-tRNA synthetase.
Functional class: J.
BeTs to -h-pc-yu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 17-547 span five regions of similarity to blocks PF00152A-D (tRNA synthetases class II.)

ProDom Summary:  Protein Domain Search
Residues 139-289 are 60% similar to a defined domain of SYD_AQUAE, and residues 418-576 are 54% similar to a defined domain of SYD_BACSU.

Paralogs:  Local Blast Search
Possible paralogs include UU286, an aspartyl-tRNA synthetase, and UU062, a lysyl-tRNA synthetase.

Pfam Summary:  Pfam Search
Residues 17 to 98 (E-value = 5.9e-17) place UU286 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)
Residues 115 to 551 (E-value = 5.9e-13) place UU286 in the tRNA-synt_2 family which is described as tRNA synthetases class II (D, K and N) (PF00152)
Residues 304 to 397 (E-value = 4.3e-10) place UU286 in the GAD family which is described as GAD domain (PF02938)

PDB Hit:
gi|6573338|pdb|1C0A|A Chain A, Crystal Structure Of The E. Coli Aspartyl-Trna Synthetase : Trnaasp : Aspartyl-Adenylate Complex

Gene Protein Sequence:
MKVYCGYIGEEHLEKNVILNGWVKKVRKMGNLVFVDLKDRFGIVQIFATK
SDGVFNELTQLSREDVINVEGLVLLRKNPNNDLKTGRFEIHVKKILIYSK
AKTPPLIIEDETDANEEIRFRYRYLDLRRDVNLKIFELRSKVYQAFRNYL
YSQDFIETETPILAKPTPEGARDFYVPTRTRKFYALPQSPQTFKQLLMVA
GFQKYFQITKCFRDEDLRSDRQPEFTQVDIELSFADEIEIQTLIENLLKY
VFKQTINVDLTTPFMRMSYEQAINDYGSDKPDLRFDLKIKTLNTYFENSK
TLFFQKALLNNQSIRAILVPNINLNKKQVQTLEKFAKDKGAKGLSWISIK
DEKIIDGSLLSIQEDHIIYKTIFKDFNLSTGSILLVADTFDIASQALGLV
RINLASILNLKKPNIFKFVWIIDWPLYEYDNEAQRFVAAHHPFTMPTLET
LNTFDVNKKDARGRSYDIVLNGYELGGGSVRIIDQQIQRRMFKSINMSDE
EANLKFGFLLTAFEYGVPPHCGIALGLDRLMMILVNSEYIRDVVAFPKNN
NGVDMMLDAPSNMNDEDLKELGLKIKND$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGTTTATTGTGGTTATATTGGTGAAGAACATTTAGAAAAAAATGT
TATTTTAAATGGTTGAGTAAAAAAAGTTCGTAAAATGGGTAATTTAGTTT
TTGTTGACCTAAAAGATCGATTTGGAATTGTACAAATTTTTGCAACAAAA
AGTGATGGTGTTTTTAATGAATTAACACAACTTTCACGTGAGGATGTAAT
TAATGTTGAAGGTTTAGTTTTGTTGAGAAAAAACCCTAATAATGATTTAA
AAACAGGTAGATTTGAAATTCATGTCAAAAAAATACTTATTTATTCAAAA
GCAAAAACACCACCATTAATTATTGAAGATGAAACTGATGCAAATGAGGA
AATTCGTTTTAGATATCGTTATTTAGATTTACGTCGTGATGTTAATTTAA
AAATTTTTGAATTGCGAAGTAAAGTTTACCAAGCTTTTAGAAATTACTTA
TATTCACAAGACTTTATTGAAACTGAAACTCCTATTTTAGCAAAACCAAC
GCCAGAAGGTGCACGAGATTTTTATGTGCCAACAAGAACTAGAAAATTTT
ATGCTTTACCACAATCACCTCAAACTTTTAAACAATTATTAATGGTTGCG
GGTTTTCAAAAATATTTTCAAATTACAAAATGTTTTCGTGATGAAGATTT
AAGAAGCGATCGTCAACCAGAATTTACTCAAGTTGATATAGAATTATCAT
TTGCTGATGAAATAGAAATTCAGACATTAATTGAAAATTTATTAAAATAT
GTTTTTAAACAAACCATTAATGTTGATTTAACAACTCCTTTTATGCGAAT
GAGTTATGAGCAAGCGATAAATGATTATGGTAGTGATAAACCAGATTTAC
GTTTTGATTTGAAAATTAAAACACTTAACACATATTTTGAAAATTCAAAA
ACATTATTTTTTCAAAAAGCACTTTTAAATAATCAAAGTATTCGTGCAAT
TTTAGTACCTAATATTAATTTAAATAAAAAACAAGTACAAACTCTTGAAA
AGTTTGCCAAAGACAAAGGTGCTAAAGGTTTAAGTTGAATAAGTATTAAA
GATGAAAAAATTATAGATGGTTCGTTATTATCAATTCAAGAAGATCATAT
AATTTATAAAACGATTTTTAAAGACTTTAATTTATCAACTGGATCAATTT
TATTAGTTGCTGATACTTTTGATATTGCATCTCAAGCATTAGGTTTAGTA
CGTATAAATTTAGCATCTATTCTTAATTTAAAAAAACCCAATATTTTTAA
ATTTGTTTGAATTATTGATTGACCATTATATGAATATGATAATGAGGCTC
AACGTTTTGTTGCTGCACACCATCCTTTCACAATGCCAACTTTAGAAACA
TTAAATACTTTTGATGTAAATAAAAAAGACGCTAGAGGTCGTAGTTATGA
TATTGTTTTAAATGGTTATGAATTAGGTGGAGGATCAGTTCGGATTATAG
ACCAACAAATTCAACGCCGTATGTTTAAATCAATTAATATGAGTGATGAA
GAGGCTAATTTAAAATTCGGTTTTTTACTAACTGCATTCGAATATGGTGT
TCCGCCACATTGTGGAATTGCTTTGGGTTTAGATCGTTTGATGATGATTT
TAGTGAATAGTGAATATATTCGCGATGTTGTTGCATTTCCTAAGAATAAC
AACGGCGTTGATATGATGTTAGACGCACCATCTAACATGAATGATGAAGA
TTTAAAAGAATTAGGTTTAAAAATAAAAAATGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy