Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR239 IGR240 IGR244 IGR243 IGR242 IGR241 IGR237 IGR238 IGR245 bsaA, - UU291 UU290 UU288 hupA, - UU282 pmsR, - UU289 deoD, - UU281 hisS, - UU285 aspS, - UU286 spoT,relA, - UU283 bsaA, - UU291 UU290 UU288 hupA, - UU282 pmsR, - UU289 deoD, - UU281 hisS, - UU285 aspS, - UU286 spoT,relA, - UU283 Type: tandem, Name:  - 168 Type: tandem, Name:  - 408 Type: tandem, Name:  - 167 Type: tandem, Name:  - 171 Type: tandem, Name:  - 165 Type: tandem, Name:  - 407 Type: tandem, Name:  - 170 Type: tandem, Name:  - 166 Type: tandem, Name:  - 169 bsaA, - UU291 UU290 pmsR, - UU289 deoD, - UU281 hisS, - UU285 aspS, - UU286 spoT,relA, - UU283 UU287 pyrG, - UU284 pyrG, - UU284 UU288 hupA, - UU282 UU287
* Calculated from Protein Sequence

Gene ID: UU285

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hisS  

Definition:
histidyl-tRNA synthetase

Gene Start:
321667

Gene Stop:
322929

Gene Length:
1263

Molecular Weight*:
48751

pI*:
9.70

Net Charge*:
7.43

EC:
6.1.1.21  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Histidine metabolism

Comment:
In HAEIN, the his-tRNA synthetase appears to be a homodimer.

Reaction:
ATP + L-HISTIDINE + TRNA(HIS) = AMP + PYROPHOSPHATE + L-HISTIDYL-TRNA(HIS).

See Prosite PDOC00363.

From Prosite:

Aminoacyl-tRNA synthetases (EC 6.1.1.-) are a group of enzymes which activate amino acids and transfer them to specific tRNA molecules as the first step in protein biosynthesis. In prokaryotic organisms there are at least twenty different types of aminoacyl-tRNA synthetases, one for each different amino acid. In eukaryotes there are generally two aminoacyl-tRNA synthetases for each different amino acid: one cytosolic form and a mitochondrial form. While all these enzymes have a common function, they are widely diverse in terms of subunit size and of quaternary structure.

The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine are referred to as class-II synthetases and probably have a common folding pattern in their catalytic domain for the binding of ATP and amino acid which is different to the Rossmann fold observed for the class I synthetases.

The complete list of predicted and possible tRNA synthetases is: UU062, UU106, UU117, UU123, UU175, UU192, UU197, UU267, UU278, UU285, UU286, UU287, UU365, UU369, UU371, UU410, UU452, UU457, UU458, UU493, UU534, and UU599.

Blast Summary:  PSI-Blast Search
Numerous significant hits to histidyl-tRNA synthetases; e.g. residues 2-415 are 37% similar to SYH_BACSU. Similar correlation occurs with hits to SYH_MYCGE, SYH_HAEIN, SYH_METJA, SYH_YEAST, and SYHH_HUMAN.
BLAST also reveals similarity to MG035, CT543, and TP0641, all of which are histidyl-tRNA synthetase sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0124 is ehgpCmyu.
Cog name: Histidyl-tRNA synthetase.
Functional class: J.
BeTs to -hg-cmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
No significant hits.

ProDom Summary:  Protein Domain Search
Residues 7-165 are 48% similar to a defined domain of SYH_BACSU, and residues 177-296 are 45% similar to SYH_MYCGE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 9 to 160 (E-value = 4.7e-39) place UU285 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
249  
420

PDB Hit:
gi|1942448|pdb|1HTT|A Chain A, Histidyl-Trna Synthetase

Gene Protein Sequence:
MINYSKPRGTIDLYNKEMNDFKLLENFLLSTTKRYGFQQIKTPVFEFAEL
FMKSAGESSDLVSKEMYLFKDKSDRWLALRPEGTAGVIRAVVENKLLLNH
PLPLKLMYFEPCFRYERPQAGRQRQFHQFGVEVLGTKNIYYDFELIALAD
TILKKLMISNYILEINYISSPHNRSLWVKSLQEYFHLHRTELTPLSQERI
TTNPLRILDDKLESQKLVVKQAPKISHFLSNEEKEEFNLIKKMLDDYNIK
YYVNEGLVRGLDYYSGLVFEFISTSPKLLGQSTIIGGGRYGELIKQTGGP
NYEGIGFGIGIERLLIALSETNKNILNTDDDKYLIAFFDKELENEAIKLT
QILRINNQLNVDIILSSTKADKIFKLAQRLNVKKLIILAKKEWSDKKIIL
KDLLNFKQDLLSLDEIKGIR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAATTACAGTAAACCACGAGGTACTATAGATTTATATAATAAAGA
AATGAATGATTTTAAATTACTTGAAAATTTTTTATTATCAACTACTAAAA
GATATGGCTTTCAGCAAATTAAAACACCTGTTTTTGAATTTGCAGAACTC
TTTATGAAATCAGCTGGTGAAAGTTCAGATTTAGTTTCAAAAGAAATGTA
TTTATTTAAAGATAAATCAGATCGCTGACTAGCGTTAAGACCTGAAGGAA
CAGCAGGTGTTATTCGTGCTGTTGTTGAGAATAAATTACTATTAAATCAT
CCACTACCATTAAAATTAATGTATTTTGAGCCTTGTTTTCGTTATGAACG
CCCTCAAGCTGGACGTCAACGCCAATTTCATCAATTTGGTGTTGAAGTGT
TGGGAACAAAAAATATTTATTATGATTTTGAATTAATTGCTTTAGCTGAT
ACAATTTTAAAAAAATTAATGATATCTAATTATATTTTAGAAATTAATTA
TATCTCATCTCCTCATAATCGTTCATTATGAGTTAAAAGTTTGCAAGAAT
ATTTTCATTTACATCGTACTGAATTAACTCCATTAAGTCAAGAACGTATT
ACAACCAATCCTTTGCGTATTTTAGATGATAAATTAGAATCTCAAAAACT
AGTTGTAAAACAAGCTCCAAAAATTAGTCATTTTTTATCAAATGAAGAAA
AAGAAGAATTTAATCTAATTAAAAAAATGCTTGATGATTATAACATTAAA
TATTATGTTAACGAAGGATTAGTAAGAGGTTTGGATTATTATAGTGGATT
AGTATTTGAATTTATTTCAACTTCACCTAAATTATTAGGTCAATCAACAA
TTATAGGTGGAGGCCGATATGGTGAATTAATTAAACAAACAGGTGGCCCT
AATTATGAAGGTATTGGTTTTGGTATAGGAATTGAACGTTTATTAATAGC
TTTATCTGAAACCAATAAAAATATTTTAAACACTGATGATGATAAATATT
TAATTGCATTTTTTGATAAAGAATTAGAGAATGAAGCTATAAAACTAACT
CAAATATTACGTATCAATAATCAATTAAATGTTGACATTATCTTAAGTTC
AACTAAAGCTGACAAAATTTTTAAGTTAGCACAACGTTTAAATGTAAAAA
AGCTTATAATATTAGCTAAAAAAGAATGATCAGATAAAAAAATAATTTTA
AAAGATTTACTTAATTTTAAACAAGATTTATTAAGTTTAGATGAAATTAA
AGGAATAAGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy