Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR239 IGR240 IGR242 IGR236 IGR241 IGR237 IGR238 UU288 hupA, - UU282 pmsR, - UU289 deoD, - UU281 celM, - UU280 hisS, - UU285 aspS, - UU286 spoT,relA, - UU283 UU288 hupA, - UU282 pmsR, - UU289 deoD, - UU281 celM, - UU280 hisS, - UU285 aspS, - UU286 spoT,relA, - UU283 Type: tandem, Name:  - 168 Type: tandem, Name:  - 167 Type: tandem, Name:  - 407 Type: tandem, Name:  - 165 Type: tandem, Name:  - 408 Type: tandem, Name:  - 170 Type: tandem, Name:  - 166 Type: tandem, Name:  - 169 hupA, - UU282 pmsR, - UU289 deoD, - UU281 celM, - UU280 hisS, - UU285 aspS, - UU286 spoT,relA, - UU283 UU287 pyrG, - UU284 pyrG, - UU284 UU288 UU287
* Calculated from Protein Sequence

Gene ID: UU284

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pyrG  

Definition:
CTP synthetase (UTP ammonia ligase)

Gene Start:
320035

Gene Stop:
321663

Gene Length:
1629

Molecular Weight*:
61336

pI*:
7.00

Net Charge*:
0.00

EC:
6.3.4.2  

Functional Class:
purines, pyrimidines, nucleosides, and nucleotides; pyrimidines  

Pathway: pathway table
Pyrimidine metabolism

Comment:
This protein is the last step in pyrimidine biosynthesis and is
activated by GTP and inhibited by CTP.

Reaction:
ATP + UTP + GLUTAMINE = ADP + ORTHOPHOSPHATE + CTP
(AMMONIA CAN REPLACE GLUTAMINE)

See Tipples and McClarty, JBC 270:7908, 1995.


Blast Summary:  PSI-Blast Search
Numerous significant hits in PSI-BLAST to sequences described as: CTP SYNTHASE (UTP--AMMONIA LIGASE) (CTP SYNTHETASE);
e.g. residues 12-538 are 39% similar to PYRG_BACSU. Similar hits occur to PYRG_METJA, PYRG_SPICI, PYRG_HELPY, PYRG_ECOLI, PYRG_MOUSE, PYRG_YEAST, and PYRG_YEAST.
BLAST also shows similarity to CT183 and TP0305, both CTP synthases. No significant similarity to M.genitalium.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0504 is Eh--cmYu.
Cog name: CTP synthase (UTP ammonia lyase).
Functional class: F.
BeTs to -h--cmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 12-398 are 47% similar to a defined domain of PYRG_BACSU, and residues 438-538 are 32% similar to a defined domain of PYRG_SYNY3, both of which are CTP synthetases and UTP ammonia ligases.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 12 to 289 (E-value = 2.2e-171) place UU284 in the CTP_synth_N family which is described as CTP synthase N-terminus (PF06418)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
301  
442

PDB Hit:


Gene Protein Sequence:
MEIDLMKHIQKTKFIFVTGGVYSSLGKGVSASSIGRILVELGYSVAMQKL
DPYLNIDPTYLSPLQHGEVFVTKDGKEADLDLGTYERFINADLNKYASVT
SGKIYYEILTKERENGFDGKTVQTIPHVTSAVIDYIKKIKDSLKTDFIIV
EIGGTIGDIESLPFIEAISQFKTIYGVNNVMFIHCSPLIYIEKVGELKTK
PTQHSVKTLRSLGINLDLLLLRTNQKLDEVTIKKLAWSCGLDIDMIFAAY
DVESVYLLPNVLFEQGIHKTILDFFSLPLKNDNINSWIDFTDKITTFKKH
NLVIGLVGKYVELPDAYKSVLASLELAAIELNIDLKIKYIQPQNLNENNI
NEELKKINGIVIPSIAGSIKGWPGALLAASYARKNNIPFLAVGTGVNIGI
GEFINNVLKLPIEFINLGNGDFSFLKDAFVKNEIENYRIGEYCSNIQANT
ITSQIYLKQNQLNERHRHHFEFNNHYINNYFLNQNWKIGAISVDNNYIDV
LEYTKNHFYVLTIFNPEYTSKPSKANPYFINLLKMSLKIKES$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGATTGATCTAATGAAACATATACAAAAAACAAAATTTATTTTTGT
AACTGGTGGTGTTTATTCATCATTAGGTAAAGGGGTTAGTGCTAGTAGTA
TTGGTCGAATTCTTGTTGAATTAGGATATAGTGTTGCAATGCAAAAGCTT
GATCCATATTTAAATATTGATCCCACTTATTTATCACCATTACAACATGG
AGAAGTATTTGTTACAAAAGACGGTAAAGAAGCAGATTTAGATTTAGGTA
CTTATGAACGTTTTATTAATGCTGATTTAAATAAATATGCGTCAGTAACT
TCAGGAAAAATTTATTATGAAATTTTAACAAAAGAGCGTGAAAATGGTTT
TGACGGTAAAACTGTTCAAACTATTCCACATGTCACATCTGCAGTTATTG
ATTACATTAAAAAAATTAAAGATAGTTTAAAAACTGATTTTATTATTGTT
GAAATTGGAGGAACAATTGGAGATATTGAATCGCTTCCATTTATTGAAGC
TATTAGTCAATTTAAAACAATTTATGGTGTAAATAATGTAATGTTTATTC
ACTGTTCACCGCTTATTTATATTGAAAAAGTAGGTGAATTAAAAACAAAA
CCAACTCAACATAGCGTTAAGACGTTACGTTCATTAGGAATTAATTTAGA
TTTATTGTTATTAAGAACTAATCAAAAATTAGATGAAGTAACGATTAAAA
AATTAGCATGATCTTGTGGATTAGATATTGATATGATTTTTGCTGCTTAT
GATGTTGAGTCAGTTTATTTATTACCAAATGTTTTGTTTGAGCAAGGGAT
TCATAAAACTATTTTAGATTTTTTTAGTCTACCTTTAAAAAATGATAATA
TTAATTCATGAATAGATTTTACTGATAAAATTACAACCTTTAAAAAACAT
AATTTAGTTATAGGTTTAGTTGGAAAATATGTTGAATTACCCGATGCTTA
TAAATCAGTATTAGCGAGTTTAGAATTAGCAGCAATTGAATTAAATATTG
ATTTAAAGATTAAATATATTCAACCCCAAAATTTAAATGAAAACAACATA
AATGAAGAACTAAAAAAAATAAATGGTATTGTTATTCCAAGTATTGCAGG
TTCAATAAAAGGCTGACCAGGAGCTTTATTAGCTGCATCTTATGCAAGAA
AAAACAATATTCCATTTTTAGCTGTGGGAACTGGCGTTAATATTGGTATT
GGTGAATTCATTAATAATGTACTAAAACTTCCAATTGAATTTATTAATTT
AGGCAATGGTGATTTTAGTTTTTTAAAAGACGCTTTCGTTAAAAATGAAA
TTGAAAATTATCGAATTGGAGAGTATTGTTCTAATATTCAAGCTAACACT
ATAACAAGCCAAATTTATCTCAAACAAAATCAATTGAACGAGCGCCATCG
TCATCATTTTGAATTTAACAATCATTATATTAATAATTATTTTTTAAATC
AAAATTGAAAAATTGGAGCAATTTCAGTGGATAATAATTATATTGATGTT
TTAGAATACACAAAAAATCATTTTTATGTTTTAACAATTTTTAATCCAGA
ATATACATCAAAACCTTCAAAGGCAAATCCTTATTTTATTAATTTATTAA
AGATGAGTTTAAAAATAAAAGAAAGTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy