Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR234 IGR239 IGR235 IGR240 IGR236 IGR237 IGR238 hupA, - UU282 deoD, - UU281 celM, - UU280 hisS, - UU285 pgk, - UU279 argS, - UU278 aspS, - UU286 spoT,relA, - UU283 hupA, - UU282 deoD, - UU281 celM, - UU280 hisS, - UU285 pgk, - UU279 argS, - UU278 aspS, - UU286 spoT,relA, - UU283 Type: tandem, Name:  - 168 Type: tandem, Name:  - 167 Type: tandem, Name:  - 407 Type: tandem, Name:  - 165 Type: tandem, Name:  - 408 Type: tandem, Name:  - 170 Type: tandem, Name:  - 166 Type: tandem, Name:  - 169 hupA, - UU282 deoD, - UU281 celM, - UU280 hisS, - UU285 pgk, - UU279 argS, - UU278 aspS, - UU286 spoT,relA, - UU283 pyrG, - UU284 pyrG, - UU284
* Calculated from Protein Sequence

Gene ID: UU283

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
spoT  relA  

Definition:
guanosine-3',5'-bis(diphosphate) 3'- pyrophosphohydrolase

Gene Start:
317894

Gene Stop:
320050

Gene Length:
2157

Molecular Weight*:
83811

pI*:
9.70

Net Charge*:
20.01

EC:
3.1.7.2  

Functional Class:
regulatory functions  

Pathway: pathway table
Purine metabolism

Comment:
The spoU gene of escherichia coli, the fourth gene of the spoT operon, is essential for tRNA (Gm18) 2 ' -O -methyltransferase activity. Reference Author: Persson BC, Jager G, Gustafsson C; Reference Location: Nucleic Acids Res 1997;25:4093-409x

See UU327, UU268, and UU124, both rRNA methylases (SPOU family).

See Rockey et al. Microbiol. 142:945 (1996).

Blast Summary:  PSI-Blast Search
Numerous significant hits in PSI-BLAST to guanosine-3',5'-bis(diphosphate) 3'- pyrophosphohydrolases and to ppGpp 3'-pyrophosphohydrolases;
e.g. residues 21-718 are 34% similar to SPOT_MYCGE, and residues 26-707 are 28% similar to SPOT_ECOLI.
BLAST also indicates strong similarity to MG278, a guanosine-3',5'-bis(diphosphate) 3'- pyrophosphohydrolase.
No significant similarity to C.trachomatis or T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0319 is EHgpC--u.
Cog name: Guanosine polyphosphate pyrophosphohydrolases/synthetases.
Functional class: K.
BeTs to e-g-c--u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 324-352 represent block PD02296 (PPGPP GTP PYROPHOSPHOKINASE ATP)
Residues 251-293, 109-151, 37-79, and 294-323 represent blocks PD02309A,B (PPGPP GTP PYROPHOSPHOKINASE ATP)

ProDom Summary:  Protein Domain Search
Residues 195-355 are 49% similar to a defined domain of SPOT_MYCGE, and residues 462-626 are 24% similar to O32419_STAAU.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 51 to 155 (E-value = 1.5e-07) place UU283 in the HD family which is described as HD domain (PF01966)
Residues 246 to 356 (E-value = 2.8e-61) place UU283 in the RelA_SpoT family which is described as Region found in RelA / SpoT proteins (PF04607)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
206  
234
non-globular  
354  
414
coil-coil  
480  
519
coil-coil  
689  
718

PDB Hit:


Gene Protein Sequence:
MNELVKKKLDDLYDFLKQKKYSSQTIELVHKSFDFANYYHGDQTRKSGEP
YIIHPIATVRILASWDMDESTLVAGMLHDVLEDTNCPEEVMEKTFGKEVT
QLVCFVTKVSLYSKNRRNKVSHTNLEEKYSIQVFMSMTQDIRAMIIKIAD
RYHNMQTIQYLRLEKAKRIATETLEIYANISGRLGMYRVKTDLLDMSFKI
LDPQNYQLVNDSINKLVENNQKKWNEILARLKNILIANNIKAEFEWRLKG
IYSTYKKITSGYEVKDIHDIYAIRVILDDVYLCYQTLGLVHMNFTYIINT
FKDYISTPKWNLYQSIHTTISYEGTLVEIQIRTTKMNLFANNGLAAHWKY
KEQKDNKTEILLTVNNVLLRDFLLSTDKGIKTIKDVTTGTIFDVLILNSN
KWITVSNGSTLLDVAYKYDINNFFNILAIYRNGERSHFDTHVETGDTIKI
SYSNGIETIRPNWITLANNDVVKLHINNHLKKYELNKQITKEQFLANAEF
FLEGKIMSEEHAIKRLEKEFQVNSINTFLDNIANTDIDLQTKYKVFSENK
QVSREAINTIKNQAWKWLADSSYFSGLENLYFTDFEISPCCSKIPGINCV
AKIVRNKVEIHRNDCSKVKNSRSKTIVIEWSKEKLENRPRYFKVNLTLKG
NWSESVGNVLCNTLIRMKANISKVDISKNKTARTHDTFLKIYVKNLDHLQ
KIILELQAKNVINEWRLI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGAATTAGTTAAAAAAAAATTAGATGATTTATATGATTTTCTTAA
ACAAAAAAAATATTCAAGCCAAACCATCGAATTAGTCCATAAATCATTTG
ATTTTGCAAACTATTATCATGGTGATCAAACAAGAAAGTCGGGAGAACCA
TATATCATTCATCCAATTGCAACTGTACGAATTTTAGCTTCATGAGATAT
GGATGAAAGTACATTAGTAGCAGGTATGTTACACGATGTTTTAGAAGACA
CAAATTGTCCAGAAGAAGTTATGGAAAAAACTTTTGGTAAAGAAGTGACG
CAACTTGTTTGTTTTGTAACAAAAGTATCTCTTTATTCAAAAAATCGACG
TAATAAAGTTTCACACACCAATCTTGAAGAAAAGTATTCAATTCAAGTGT
TTATGTCAATGACACAAGACATTCGTGCTATGATTATTAAAATTGCTGAT
CGTTATCATAATATGCAAACTATTCAATACTTACGTTTAGAAAAAGCGAA
AAGAATTGCAACAGAAACACTAGAAATTTACGCAAATATTTCTGGAAGAT
TAGGGATGTATCGTGTTAAAACAGATTTATTAGATATGTCTTTTAAAATT
TTAGACCCACAAAATTATCAATTAGTAAACGATTCAATTAATAAATTGGT
TGAAAACAATCAAAAAAAATGAAATGAAATTTTAGCTCGTTTAAAAAATA
TTTTAATAGCTAATAATATTAAGGCTGAATTTGAATGGCGTCTTAAAGGT
ATTTACTCAACATATAAAAAAATAACTAGTGGTTATGAAGTTAAAGATAT
TCATGATATCTATGCTATACGTGTAATTTTAGATGATGTATATTTATGTT
ATCAAACATTAGGTTTAGTACACATGAATTTTACGTATATTATTAACACT
TTTAAAGATTATATTTCAACACCAAAATGAAATTTATACCAATCTATTCA
TACAACAATTTCGTATGAAGGAACTTTAGTAGAAATTCAAATCAGAACAA
CAAAAATGAATTTATTTGCTAATAATGGTTTAGCAGCACACTGAAAATAT
AAAGAACAAAAAGATAATAAAACTGAAATTTTATTAACAGTTAATAATGT
TTTATTGCGTGATTTTTTATTGAGCACAGATAAAGGAATTAAAACTATTA
AAGATGTCACAACCGGAACTATTTTTGATGTACTAATTCTTAATTCTAAT
AAATGAATCACTGTTTCAAATGGTTCAACATTATTAGATGTAGCATATAA
ATACGATATAAATAATTTTTTCAATATTTTAGCAATTTATCGGAATGGTG
AGCGTTCACATTTTGACACGCATGTAGAAACTGGCGATACAATTAAAATT
AGTTATTCAAATGGAATTGAAACAATTAGACCAAACTGGATTACATTAGC
TAATAATGATGTTGTTAAATTACATATTAACAATCATTTAAAAAAATATG
AACTGAATAAACAAATTACAAAAGAACAATTTTTAGCTAATGCTGAATTT
TTTTTAGAAGGCAAAATTATGAGTGAAGAGCATGCTATTAAAAGACTAGA
AAAAGAATTTCAAGTTAATAGTATCAATACTTTTTTAGATAATATTGCTA
ATACTGACATTGATTTACAAACAAAATATAAAGTATTTTCAGAAAATAAA
CAAGTTTCACGTGAAGCAATTAATACAATTAAAAATCAAGCATGAAAATG
ATTAGCTGATTCTTCATATTTTAGTGGTCTAGAGAACTTGTATTTTACAG
ATTTTGAAATTTCGCCTTGTTGTTCTAAAATTCCTGGAATTAATTGTGTT
GCTAAAATTGTTCGCAATAAAGTAGAAATTCACCGCAATGATTGTTCTAA
AGTTAAAAATTCTCGCTCAAAAACAATTGTAATTGAATGATCAAAAGAAA
AACTTGAGAATCGTCCGCGTTATTTTAAAGTTAACTTAACATTAAAAGGC
AATTGAAGTGAATCTGTTGGAAATGTTTTATGCAACACATTAATACGCAT
GAAAGCAAATATTTCAAAAGTTGATATTAGTAAAAATAAGACTGCACGCA
CTCATGATACTTTTTTAAAAATTTATGTAAAAAACTTAGATCACTTACAA
AAGATTATTTTAGAACTTCAAGCTAAAAATGTTATTAATGAATGGAGATT
GATCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy