Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR234 IGR239 IGR235 IGR236 IGR232 IGR237 IGR238 IGR233 UU277 hupA, - UU282 deoD, - UU281 celM, - UU280 UU276 hisS, - UU285 pgk, - UU279 argS, - UU278 spoT,relA, - UU283 UU277 hupA, - UU282 deoD, - UU281 celM, - UU280 UU276 hisS, - UU285 pgk, - UU279 argS, - UU278 spoT,relA, - UU283 Type: tandem, Name:  - 167 Type: tandem, Name:  - 408 Type: tandem, Name:  - 166 Type: tandem, Name:  - 170 Type: tandem, Name:  - 164 Type: tandem, Name:  - 407 Type: tandem, Name:  - 169 Type: tandem, Name:  - 165 Type: tandem, Name:  - 168 hupA, - UU282 deoD, - UU281 celM, - UU280 UU276 pgk, - UU279 argS, - UU278 spoT,relA, - UU283 pyrG, - UU284 pyrG, - UU284 hisS, - UU285 UU277
* Calculated from Protein Sequence

Gene ID: UU281

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
deoD  

Definition:
purine nucleoside phosphorylase

Gene Start:
316587

Gene Stop:
317306

Gene Length:
720

Molecular Weight*:
26257

pI*:
5.80

Net Charge*:
-3.18

EC:
2.4.2.1  2.7.-.-  

Functional Class:
purines, pyrimidines, nucleosides, and nucleotides; salvage of nucleosides and nucleotides  

Pathway: pathway table
Nicotinate and nicotinamide metabolism
Purine metabolism
Pyrimidine metabolism

Comment:
See Prosite PDOC00946.

This enzyme catalyzes the cleavage of guanosine or inosine to respective bases and sugar-1-phosphate molecules.

See UU368, a predicted deoA sequence; UU470, a predicted deoD sequence; and UU585, a predicted deoC sequence.

Blast Summary:  PSI-Blast Search
Numerous significant hits in PSI-BLAST to purine nucleoside phosphorylases; e.g. residues 1-239 are 52% similar to DEOD_MYCPN, and residues 2-236 are 41% similar to DEOD_ACTPL.
BLAST also reveals similarity to MG049 and TP0734, both of which are purine nucleoside phosphorylases. Also a lesser degree of similarity to TP1027, a uridine phosphorylase.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0813 is EHgp---u.
Cog name: Purine-nucleoside (and uridine) phosphorylase.
Functional class: F.
BeTs to e--p---u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 13-213 span six regions of similarity to blocks BL01232A-E which encompass Purine and other phosphorylases family 1 proteins; e.g. DEOD_HELPY.

ProDom Summary:  Protein Domain Search
Residues 1-235 are 52% similar to a defined domain of DEOD_MYCPN.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 14 to 235 (E-value = 2.5e-63) place UU281 in the PNP_UDP_1 family which is described as Phosphorylase family (PF01048)

PDB Hit:
gi|1633413|pdb|1ECP|A Chain A, Purine Nucleoside Phosphorylase

Gene Protein Sequence:
MTAHNQAKLGEIAKVVLMPGDPMRAKWIAETFLENAILVNEVRGMLCYTG
TYKGKKISIMGHGMGIPSIGIYSYELYKFYEVETIIRVGSTGSYKKDLNV
NDVVLVEKSYSDSTFASLIGAQVGDDKVLLPSREVNNLIKNTAKELNLEL
SLATCHASDVFYNNDFQTLDEIIHRTKSDCVDMESFGLFANAQILNKNAA
TLLTVSDSLITGDALSPAERANTFKKMVTLALESAIKLL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTGCACATAATCAAGCTAAATTAGGAGAAATAGCTAAAGTAGTACT
AATGCCAGGGGACCCAATGCGCGCTAAATGAATTGCTGAAACTTTTTTAG
AAAATGCAATTTTAGTTAATGAAGTTCGTGGCATGCTATGCTATACAGGA
ACATATAAAGGCAAAAAAATATCAATTATGGGCCATGGTATGGGAATTCC
TTCGATCGGAATTTATTCATATGAATTATATAAATTTTATGAAGTTGAAA
CAATTATTCGTGTTGGTTCAACTGGTTCATATAAAAAAGATTTGAATGTT
AATGATGTGGTTTTAGTTGAAAAATCATATAGTGATTCTACATTCGCATC
ACTGATTGGTGCACAAGTTGGCGATGATAAGGTTTTATTACCATCAAGAG
AAGTTAATAATTTAATTAAAAATACTGCGAAGGAATTAAATTTAGAATTA
TCATTAGCAACTTGTCATGCTTCTGATGTGTTTTATAATAATGATTTTCA
AACATTAGATGAAATTATTCATCGAACTAAATCCGATTGTGTTGATATGG
AATCATTTGGTTTATTCGCAAATGCACAAATTTTAAATAAAAATGCAGCA
ACTTTACTAACAGTTAGTGATTCATTGATTACAGGTGATGCACTATCACC
CGCAGAGCGTGCTAATACTTTTAAAAAAATGGTAACATTAGCCTTAGAAA
GCGCAATTAAATTACTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy