Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR234 IGR231 IGR235 IGR236 IGR232 IGR237 IGR238 IGR233 UU277 hupA, - UU282 UU275 deoD, - UU281 UU276 celM, - UU280 pgk, - UU279 argS, - UU278 spoT,relA, - UU283 UU277 hupA, - UU282 UU275 deoD, - UU281 UU276 celM, - UU280 pgk, - UU279 argS, - UU278 spoT,relA, - UU283 Type: tandem, Name:  - 167 Type: tandem, Name:  - 166 Type: tandem, Name:  - 407 Type: tandem, Name:  - 164 Type: tandem, Name:  - 408 Type: tandem, Name:  - 169 Type: tandem, Name:  - 165 Type: tandem, Name:  - 168 UU277 hupA, - UU282 deoD, - UU281 UU276 celM, - UU280 pgk, - UU279 argS, - UU278 spoT,relA, - UU283 pyrG, - UU284 pyrG, - UU284 UU275
* Calculated from Protein Sequence

Gene ID: UU280

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
celM  

Definition:
endoglucanase M

Gene Start:
315422

Gene Stop:
316513

Gene Length:
1092

Molecular Weight*:
40292

pI*:
6.10

Net Charge*:
-4.19

EC:
3.2.1.4  

Functional Class:
energy metabolism; starch and sucrose metabolism  

Pathway: pathway table
Starch and sucrose metabolism

Comment:


Blast Summary:  PSI-Blast Search
Several significant hits in PSI-BLAST to predicted endoglucanases, but far more hits to hypothetical protein sequences. E.g. residues 14-345 are 32% similar to Y555_METJA, a hypothetical protein. Residues 6-347 are 33% similar to GUNM_CLOTH, an englucanase.

No similarity to M.genitalium, C.trachomatis, or T.pallidum.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 92-345 are 38% similar to a defined domain of O59196_PYRHO, a protein hydrolase glycosidase.
Residues 49-85 are 64% similar to a defined domain of P94521_BACSU, a protein hydrolase glycosidase.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 50 to 344 (E-value = 7.5e-139) place UU280 in the Peptidase_M42 family which is described as M42 glutamyl aminopeptidase (PF05343)

PDB Hit:


Gene Protein Sequence:
MSKFNEKEIRNKAIEYMEIYGMSRHEERVASKLKASLKDAGVDYERDNLG
SIIFKKTNSNKGPKILIATHMDEVGFVVQQILDNGQLLLSMVGGVWPNIA
IGSVAKVYVDEQRQYTGVFGHTSIHILEPEARSKAVPVKELFVDCGFNSK
QQAIDLGIEIGTEVYMEGPTLNFYDENYIVGKAVDNRVSVAVLDLLIHSL
KDKVIPNQTYFAATVQEEVGLRGAKTVVSKVKPDIGIVIDTTTSHDTYKC
PEGDTKLNDGVCIRIKDGGTLVNPKLVKYFEELAIKHNIPLYKYVARGGG
TDAEELQYGPNGGVLTIGLSIPQRYLHAPIGVATVKDIKAAFDLVREFLE
VFDENEFEKVKFK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTAAATTTAACGAAAAAGAAATTAGAAATAAAGCAATTGAATATAT
GGAAATATATGGTATGTCACGTCATGAAGAACGTGTTGCTTCCAAACTAA
AAGCATCATTAAAAGATGCGGGAGTTGATTATGAACGTGATAATTTAGGT
TCAATTATTTTTAAAAAAACAAATTCAAATAAAGGACCTAAAATCTTAAT
TGCTACACACATGGATGAAGTTGGTTTTGTAGTTCAACAAATTCTTGATA
ATGGTCAATTACTATTATCAATGGTAGGTGGTGTATGGCCTAATATTGCT
ATTGGATCAGTAGCAAAAGTGTATGTTGATGAACAACGTCAATATACTGG
TGTATTTGGCCATACTTCAATTCATATCTTAGAACCTGAAGCACGCAGTA
AAGCAGTTCCAGTTAAAGAATTATTTGTTGATTGCGGTTTTAATTCAAAA
CAACAAGCTATTGATTTAGGAATTGAAATAGGTACGGAAGTTTATATGGA
AGGACCAACTTTAAATTTTTATGATGAAAATTATATTGTTGGTAAAGCTG
TTGATAATCGTGTAAGTGTTGCGGTTTTAGATTTATTAATACATAGTTTA
AAGGACAAAGTAATTCCCAACCAAACTTATTTTGCTGCAACAGTGCAAGA
AGAAGTTGGATTACGTGGCGCAAAAACAGTTGTTTCAAAAGTAAAACCTG
ATATTGGGATTGTTATTGATACAACAACATCACACGATACATACAAGTGT
CCAGAGGGTGATACAAAATTAAATGATGGTGTATGTATTAGAATTAAAGA
TGGTGGAACTTTAGTTAATCCTAAATTAGTAAAATATTTTGAAGAATTAG
CTATTAAACACAACATTCCTTTATATAAATATGTTGCACGAGGAGGCGGG
ACTGATGCTGAAGAATTGCAATATGGGCCTAATGGTGGAGTATTAACAAT
TGGTTTGTCTATCCCACAACGTTATTTACATGCTCCAATTGGCGTAGCAA
CGGTTAAAGATATAAAAGCAGCCTTTGACTTAGTACGTGAGTTTTTAGAA
GTATTTGATGAAAACGAATTTGAAAAAGTAAAATTTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy