Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR234 IGR231 IGR235 IGR236 IGR232 IGR237 IGR238 IGR233 IGR230 hemN, - UU274 UU277 hupA, - UU282 UU275 deoD, - UU281 celM, - UU280 UU276 pgk, - UU279 argS, - UU278 spoT,relA, - UU283 hemN, - UU274 UU277 hupA, - UU282 UU275 deoD, - UU281 celM, - UU280 UU276 pgk, - UU279 argS, - UU278 spoT,relA, - UU283 Type: tandem, Name:  - 166 Type: tandem, Name:  - 408 Type: tandem, Name:  - 165 Type: tandem, Name:  - 169 Type: tandem, Name:  - 163 Type: tandem, Name:  - 407 Type: tandem, Name:  - 168 Type: tandem, Name:  - 164 Type: tandem, Name:  - 167 hemN, - UU274 UU277 hupA, - UU282 UU275 deoD, - UU281 celM, - UU280 UU276 pgk, - UU279 argS, - UU278 spoT,relA, - UU283
* Calculated from Protein Sequence

Gene ID: UU279

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgk  

Definition:
phosphoglycerate kinase

Gene Start:
314150

Gene Stop:
315418

Gene Length:
1269

Molecular Weight*:
47371

pI*:
5.40

Net Charge*:
-7.61

EC:
2.7.2.3  

Functional Class:
energy metabolism; glycolysis and gluconeogenesis  

Pathway: pathway table
Carbon fixation
Glycolysis / Gluconeogenesis

Comment:
From Prosite PDOC00102:
Phosphoglycerate kinase (EC 2.7.2.3)(PGK) catalyzes the second step in the second phase of glycolysis, the reversible conversion of 1,3-diphospho-glycerate to 3-phosphoglycerate with generation of one molecule of ATP. PGK is found in all living organisms and its sequence has been highly conserved throughout evolution. It is a two-domain protein; each domain is composed of six repeats of an alpha/beta structural motif.

Reference: Biochem. Soc. Trans. 1990 (18):187-190.

In B.subtilis, this protein is the first in a large operon coding for glycolytic enzymes along with (in order), tpi, pgm and eno. See gene records UU181 (tpi), UU182 (pgm) and UU184 (eno) for the other glycolytic genes.

Blast Summary:  PSI-Blast Search
A gapped BLAST reveals significant hits to a number of proteins described as phosphoglycerate kinase (pgk). For example: residues 2-411 are 38% similar to PGK_MYCGE. Other significant hits are seen against (but not limited to) the pgk proteins of L.delbrueckii (PGK_LACDE), T.maritima (2120367) and P.nigra (3738257). Significant hits were seen in both eukaryotic and prokaryotic organisms.

A BLAST against the STDPRO database reveals significant hits to a protein in each of the following genomes: C.trachomatis, M.genitalium and T.palldium. In all cases, these proteins are described as phosphoglycerate kinase (pgk). For reference: residues 2-411 are 39% similar to MG300, residues 4-411 are 33% similar to CT693, and residues 7-412 are 29% similar to TP0538.


COGS Summary:  COGS Search
The phylogenetic pattern of is ehgpcmyu.
Cog name: 3-phosphoglycerate kinase.
Functional class: C.
BeTs to .
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 16-29, 59-70, 77-101, 120-134, 159-179, 188-234, 251-290, 313-348 and 387-408 rank in the 99.97th percentile to Block BL00111 (A through I respectively), described as Phosphoglycerate kinase proteins.


ProDom Summary:  Protein Domain Search
Residues 17-411 are 40% similar to a defined domain of PGK_MYCPN.

Paralogs:  Local Blast Search
No paralogs found in U.u.

Pfam Summary:  Pfam Search
Residues 4 to 415 (E-value = 4e-71) place UU279 in the PGK family which is described as Phosphoglycerate kinase (PF00162)

PDB Hit:
gi|3318871|pdb|1VPE| Crystallographic Analysis Of Phosphoglycerate Kinase From The Hyperthermophilic Bacterium Thermotoga Maritima

Gene Protein Sequence:
MNSLNKKSIKDLDVNGKTIVLHLDLNVVVDYENKRILNDRKLRASLPTIN
YLINHNAKIVILSHLGRIKTLADKQSGKYSLEIIVDELRNRVSKNVNRVV
FSPLNYGETVVQMVNDLEERDILILENTRYCDISDEGEYVGLEWDGSEIL
GQFWGMLGDIFIDDAYGVAHRQLSSNYQTAKFAKKSALGFLIVNEINHLD
IALEVPKSPYLALIGGNRVADKIAAIEVLCERADQVIIGGGLVYTFLYAQ
GYNVGLNLVERNMIDDCNNILEKYGKKILICFDFLCNNDFSDTRPIYRKI
DEGLEGLYGLDIGKRSLKFIKHEIYRSKTILLNGPFGVIENIKNYAQGTT
EICKSMAKQTTRGAYTIICDIDTSSHAEYLGLDKYINFISTGGGASLSYI
EEGVLDGLETIDNVPLNVLKKE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAGTTTAAATAAAAAAAGTATAAAAGATCTTGATGTAAATGGTAA
AACAATAGTTTTACATTTAGATTTAAATGTTGTTGTTGATTATGAAAATA
AACGCATATTAAATGATCGTAAATTACGAGCATCACTACCAACTATTAAT
TATTTAATTAATCATAACGCTAAAATTGTTATTTTAAGTCATTTAGGTCG
AATTAAAACCTTAGCAGATAAACAAAGTGGTAAATATAGTTTAGAAATTA
TTGTTGATGAACTCCGTAATCGTGTATCCAAGAATGTTAATCGTGTTGTA
TTTTCACCTTTAAATTATGGAGAAACGGTCGTACAAATGGTTAATGATTT
AGAAGAAAGAGACATTTTAATTTTAGAAAATACGCGTTATTGTGATATTA
GTGATGAAGGTGAATATGTTGGGCTTGAATGAGATGGTTCAGAGATTTTA
GGACAGTTTTGGGGAATGCTAGGGGATATTTTTATTGATGATGCATATGG
AGTTGCTCATCGACAATTATCATCAAATTATCAAACAGCTAAATTTGCTA
AAAAAAGTGCATTAGGTTTTTTAATTGTTAATGAAATTAACCATCTAGAT
ATTGCTTTAGAAGTTCCTAAAAGTCCGTATTTAGCTTTAATAGGTGGTAA
CCGTGTTGCTGATAAAATTGCAGCAATTGAAGTATTATGTGAACGGGCTG
ATCAAGTTATTATTGGGGGAGGATTAGTCTATACATTTTTATATGCTCAA
GGGTATAACGTTGGTTTAAATTTAGTAGAACGCAATATGATTGATGATTG
CAATAATATATTAGAAAAATACGGTAAAAAAATTTTAATTTGTTTTGATT
TTTTATGTAACAATGATTTTAGTGATACAAGACCGATTTATCGTAAAATA
GATGAAGGTCTTGAAGGGTTATATGGTTTAGATATTGGTAAAAGAAGTTT
AAAATTTATTAAACATGAAATTTATCGTTCTAAAACTATTTTACTAAATG
GTCCCTTTGGTGTTATTGAAAATATTAAGAATTATGCACAAGGTACTACT
GAAATATGTAAATCAATGGCAAAACAAACAACACGTGGCGCTTATACAAT
TATATGTGATATCGATACTTCGAGTCATGCTGAATACCTAGGATTAGATA
AATATATTAATTTTATATCTACTGGTGGGGGCGCTAGCTTATCATATATT
GAAGAAGGAGTTCTTGATGGTCTTGAAACCATTGATAATGTTCCTTTAAA
TGTTTTAAAGAAGGAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy