Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR234 IGR231 IGR235 IGR236 IGR232 IGR237 IGR238 IGR233 IGR230 hemN, - UU274 UU277 hupA, - UU282 UU275 deoD, - UU281 UU273 celM, - UU280 UU276 pgk, - UU279 argS, - UU278 spoT,relA, - UU283 hemN, - UU274 UU277 hupA, - UU282 UU275 deoD, - UU281 UU273 celM, - UU280 UU276 pgk, - UU279 argS, - UU278 spoT,relA, - UU283 Type: tandem, Name:  - 165 Type: tandem, Name:  - 164 Type: tandem, Name:  - 407 Type: tandem, Name:  - 162 Type: tandem, Name:  - 408 Type: tandem, Name:  - 167 Type: tandem, Name:  - 163 Type: tandem, Name:  - 166 hemN, - UU274 UU277 hupA, - UU282 UU275 deoD, - UU281 UU273 celM, - UU280 UU276 pgk, - UU279 argS, - UU278 spoT,relA, - UU283
* Calculated from Protein Sequence

Gene ID: UU278

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
argS  

Definition:
arginyl-tRNA synthetase

Gene Start:
312495

Gene Stop:
314147

Gene Length:
1653

Molecular Weight*:
63652

pI*:
8.20

Net Charge*:
4.07

EC:
6.1.1.19  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Arginine and proline metabolism

Comment:
The complete list of predicted and possible tRNA synthetases is: UU062, UU106, UU117, UU123, UU175, UU192, UU197, UU267, UU278, UU285, UU286, UU287, UU365, UU369, UU371, UU410, UU452, UU457, UU458, UU493, UU534, and UU599.

Blast Summary:  PSI-Blast Search
Numerous significant hits in PSI-BLAST to arginyl-tRNA synthetases; e.g. residues 26-549 are 32% similar to SYR_CORGL, and residues 26-549 are 32% similar to SYR_BRELA.
BLAST also shows similarity to MG378, TP0831, and CT454, all of which are arginyl-tRNA synthetases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0018 is ehgpcmYu.
Cog name: Arginyl-tRNA synthetase.
Functional class: J.
BeTs to -hg-cmyu.
Number of proteins in this genome belonging to this COG is 2



Blocks Summary:  Blocks Search
Resiued 125-134 and 336-345 represent block BL00178A (Aminoacyl-transfer RNA synthetases class-I proteins.)

ProDom Summary:  Protein Domain Search
Residues 157-549 are 40% similar to a defined domain of SYR_BACSU, and residues 6-152 are 31% similar to a defined domain of SYR_MYCGE, both of which are arginyl-tRNA synthetases.

Paralogs:  Local Blast Search
No significant evidence of paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 1 to 87 (E-value = 1.5e-28) place UU278 in the Arg_tRNA_synt_N family which is described as Arginyl tRNA synthetase N terminal domain (PF03485)
Residues 95 to 420 (E-value = 1.2e-69) place UU278 in the tRNA-synt_1d family which is described as tRNA synthetases class I (R) (PF00750)
Residues 435 to 549 (E-value = 3e-43) place UU278 in the tRNA-synt_1d_C family which is described as DALR anticodon binding domain (PF05746)

PDB Hit:
gi|5821887|pdb|1BS2|A Chain A, Yeast Arginyl-Trna Synthetase

Gene Protein Sequence:
MITQKISEELNKALAKMGIHDTQETKILVDKTKNIKFGDFYTNIAMILSK
KNNKSSLEIAKEIANNFEQDLFLEVNLQPPGFLNFKLKAKDHENLLKQIY
YEKDRFGQFSKKNITYNIEYVSANPTGYLHIAHAANAIYGDILANLLKIY
GYDVETEYWINDAGNQIDKLAMSVLVRYLQLQNINIQLPADAYHGQEIHL
VAQTLYQTYKNQFINVRLNEKYEIDDDIANQEIKNFAVKYLLNEIKNDLA
SINTFIDTYTSENWIRNSGRILEVLSKIKPYTYTLDGALWLKTTTFGDDK
DRVLIKSDGSYTYFTPDIAYHDYKFNKTNTTKLIDVWGTDHLGYIARLKA
AMNALGYDPNNLEIVCAQVMKLVKNNQEFKLSKRSGQSLTIKDLVEIIGK
DALRWFLGSSSMNSHVIIDVDIALSKNNNNPLYYVQYAHARANQVLNKQV
YELDFKTDLLTETRERELLNQLHFYKQTIANAANNREPHRISNYLYDLAQ
IFHNYYANVKINNDNNKVLSAQRYTLVWCVKQVLANGLAIMKITPYDQMY
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTACACAAAAAATAAGTGAAGAATTAAATAAGGCTTTGGCGAAAAT
GGGTATTCATGATACACAGGAGACAAAGATTCTCGTTGATAAAACTAAAA
ATATTAAATTTGGTGATTTTTATACTAACATAGCAATGATTTTAAGTAAA
AAAAATAATAAGAGTTCTTTAGAAATAGCTAAAGAAATAGCTAATAATTT
TGAACAAGATTTGTTTTTAGAAGTTAATTTGCAGCCACCTGGATTTTTAA
ATTTTAAATTAAAAGCAAAAGATCATGAAAATTTATTGAAACAAATTTAT
TATGAAAAAGATAGATTTGGTCAATTCTCTAAAAAGAATATCACTTATAA
TATTGAATATGTTTCAGCTAACCCCACAGGTTATTTGCATATTGCTCACG
CTGCTAATGCTATTTATGGTGATATTTTAGCTAATTTATTAAAAATTTAT
GGATATGATGTAGAAACTGAATATTGAATTAATGATGCTGGAAATCAAAT
TGATAAATTAGCAATGTCAGTGTTAGTTCGTTATTTACAATTACAAAATA
TTAATATTCAATTACCAGCAGATGCCTACCATGGGCAAGAAATTCATTTA
GTTGCACAAACTTTATACCAAACTTATAAAAATCAATTTATTAATGTACG
TTTAAATGAAAAATATGAAATTGATGATGATATTGCTAATCAAGAAATTA
AAAATTTTGCAGTTAAATACTTATTAAATGAAATTAAAAACGATTTAGCA
TCAATTAACACATTCATTGATACTTATACTTCAGAAAATTGAATTCGAAA
TTCGGGACGTATTTTAGAAGTTTTATCAAAAATAAAACCTTACACTTATA
CACTAGATGGTGCTTTGTGATTAAAAACAACTACTTTTGGTGATGATAAA
GATCGTGTTTTAATTAAATCTGATGGTTCATATACATATTTCACACCAGA
TATTGCTTATCATGACTATAAATTTAATAAGACAAATACAACTAAATTAA
TTGATGTGTGGGGTACAGATCATTTAGGTTATATTGCGCGTTTAAAAGCG
GCAATGAATGCTTTAGGTTATGATCCAAATAATTTAGAAATTGTTTGTGC
TCAAGTAATGAAATTAGTTAAAAATAATCAAGAATTTAAACTTTCAAAAA
GGAGCGGACAATCATTAACAATCAAGGATTTAGTTGAAATTATTGGTAAA
GATGCATTACGTTGATTTTTAGGGTCATCATCTATGAATTCGCATGTTAT
TATTGATGTAGATATTGCCTTATCAAAAAATAACAATAATCCTTTATATT
ATGTTCAATACGCACATGCTCGTGCCAATCAAGTATTAAATAAACAAGTT
TATGAATTAGATTTTAAAACTGATCTATTAACAGAAACACGTGAACGTGA
ATTGTTGAATCAACTTCATTTCTATAAACAAACAATTGCTAATGCTGCAA
ATAATCGTGAACCACACCGAATTAGTAATTATTTATATGACTTAGCTCAA
ATTTTTCATAATTATTATGCAAATGTTAAAATTAATAATGATAATAATAA
AGTTCTATCAGCACAACGTTATACATTAGTATGATGTGTTAAACAGGTTT
TAGCTAATGGTTTGGCAATTATGAAAATAACTCCATATGATCAGATGTAT
TAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy