Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap tRNA-His-1 IGR225 IGR224 IGR226 IGR228 IGR223 IGR227 pacL, - UU264 UU265 spoU, - UU268 UU270 UU269 UU271 valS, - UU267 pacL, - UU264 UU265 spoU, - UU268 UU270 UU269 UU271 valS, - UU267 Type: tandem, Name:  - 155 Type: tandem, Name:  - 160 Type: tandem, Name:  - 406 Type: tandem, Name:  - 154 Type: tandem, Name:  - 158 Type: tandem, Name:  - 152 Type: tandem, Name:  - 405 Type: tandem, Name:  - 159 Type: tandem, Name:  - 157 Type: tandem, Name:  - 153 Type: tandem, Name:  - 161 Type: tandem, Name:  - 156 pacL, - UU264 spoU, - UU268 UU270 UU269 UU271 valS, - UU267 hit, - UU272 UU266 hit, - UU272 UU265 UU266
* Calculated from Protein Sequence

Gene ID: UU267

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
valS  

Definition:
valyl-tRNA synthetase

Gene Start:
301653

Gene Stop:
304277

Gene Length:
2625

Molecular Weight*:
103353

pI*:
8.20

Net Charge*:
7.99

EC:
6.1.1.9  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Valine, leucine and isoleucine biosynthesis

Comment:
See Prosite PDOC00161.

From Prosite:

Aminoacyl-tRNA synthetases (EC 6.1.1.-) are a group of enzymes which activate amino acids and transfer them to specific tRNA molecules as the first step in protein biosynthesis. In prokaryotic organisms there are at least twenty different types of aminoacyl-tRNA synthetases, one for each different amino acid. In eukaryotes there are generally two aminoacyl-tRNA synthetases for each different amino acid: one cytosolic form and a mitochondrial form. While all these enzymes have a common function, they are widely diverse in terms of subunit size and of quaternary structure.

The complete list of predicted and possible tRNA synthetases is: UU062, UU106, UU117, UU123, UU175, UU192, UU197, UU267, UU278, UU285, UU286, UU287, UU365, UU369, UU371, UU410, UU452, UU457, UU458, UU493, UU534, and UU599.

Blast Summary:  PSI-Blast Search
Numerous hits in PSI-BLAST to valyl-tRNA synthetases; e.g. residues 14-842 are 43% similar to SYV_BACST, and residues 15-843 is 36% similar to SYV_SYNY3.
Also hits to SYV_ECOLI, SYV_YEAST, SYV_ARATH, SYV_HUMAN, and SYV_RAT.
BLAST also reveals similarity to MG334, CT302, and TP1035, all of which are valyl-tRNA synthetase sequences. Similarity of a lesser magnitude to MG345, CT019, and TP0452, which are isoleucyl-tRNA synthetase sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0525 is ehgpcmyu.
Cog name: Valyl-tRNA synthetase.
Functional class: J.
BeTs to -hg-cmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 48-57 and 520-530 represent blocks BL00178A,B (Aminoacyl-transfer RNA synthetases class-I proteins.)

ProDom Summary:  Protein Domain Search
Residues 189-340 are 48% similar to a defined domain of SYV_HELPY.
Residues 46-179 are 52% similar to a defined domain of SYV_LACCA.
Residues 513-627 are 49% similar to a defined domain of SYV_MYCGE.
All of the above are related to valyl-tRNA synthetase.

Paralogs:  Local Blast Search
Several apparent paralogs exist (listed in order of similarity):

UU410 ileS; isoleucyl-tRNA synthetase
UU371 leuS; leucyl-tRNA synthetase
UU197 metS; methionyl-tRNA synthetase

Pfam Summary:  Pfam Search
Residues 17 to 563 (E-value = 2e-207) place UU267 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
666  
802
coil-coil  
810  
874

PDB Hit:
gi|4930049|pdb|1ILE| Isoleucyl-Trna Synthetase

Gene Protein Sequence:
VKKKLSKKYSFKEVEANKLLFWQENNLFKAQINSTKKPFTIVLPPPNVTG
HLHIGHAYDFTLSDILMRYKKLKGYDSFIIPGTDHAGIATQTKFEKNLKV
NAQTNRFNLGRELFLEKLKIWKDEQINYIHKQWNALGLGLDYSNYLFTLD
PIVVQTVREVFVKMFNEHIIYRDKKLVNWDIQLKTAISNIEVIHKEVEQK
LYYIKYLSQDQKDFVVVATSRPETMFGDKYLVINPKDKRYFHLHNKIFIN
PINNIEMTVILDDYIDIEFGTGVMKCTPAHDFNDYELAKKHNLEIINIMN
ADGTLNEKCGEFKGLDRLEARSLIIDKLQKNNHLLKVESYRTSVGFSERT
NEIVEPYLSHQWFIKMDSLIKDTIKMQDDCNNKVDFYPNRFNKTLLTWLK
NTEDWCISRQLWWGHQIPVWYHKKTNQIYCDTIPPKDLENWIQDEDVLDT
WFSSGMWPLLTTKWNYNSHFFDRYFPTSLIVTGMDILFFWVSRMMNFSQY
LVEKKPFKDVLIHGLIRDSQGRKMSKSLGNGIDPFDIIDKYGLDAMRLFF
ASCTTIGEDLNFSTERLGANWNYLNKIWNIAKYIENLDEINDNLNFEDVD
KFCDVNKWILTELSKLTLEINKNMDKYNLVVATKYLYDFIWNTFASYYLE
YTKVLLQDLTLKNETIKTIRYVFNKILIMLQPFAPNISEEIWLCLNQTNN
SILLQEYPIINFEFETIIIDKIAKIILEIRKLRLEENINNRINLCFELIS
PNDAFYKSKIKLVNLLLILVNAEINEIKKTSSNNYTYELVIDDFILKTSY
EKPIDYVFQMKKASEQLNYLENEIQRATNLLNNSGFINKAPAQLIIKEKN
KLINLKKEHANLLKTLTDLKQKVK$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAGAAGAAATTAAGTAAGAAGTATTCATTCAAAGAGGTTGAAGCTAA
TAAATTATTGTTTTGACAAGAAAATAATTTATTTAAAGCTCAAATAAATA
GTACAAAAAAACCTTTCACAATTGTTTTGCCCCCTCCTAATGTTACAGGT
CATTTACATATTGGACATGCCTATGATTTTACCTTATCTGATATTTTAAT
GCGTTATAAGAAACTAAAAGGATATGATTCCTTTATTATTCCTGGGACAG
ACCATGCAGGGATCGCAACACAGACAAAATTTGAAAAAAATTTAAAAGTA
AACGCACAAACCAATCGTTTCAATTTAGGGCGAGAACTGTTTTTAGAAAA
GTTAAAAATTTGAAAAGATGAACAAATTAATTATATTCATAAACAATGAA
ATGCTTTAGGTTTGGGTTTAGATTATAGTAATTATTTATTTACATTAGAT
CCAATAGTTGTTCAAACAGTGCGCGAAGTTTTTGTAAAAATGTTTAATGA
ACATATTATTTATCGTGATAAAAAATTAGTTAATTGAGATATTCAATTAA
AAACGGCAATTAGTAATATTGAAGTGATTCATAAAGAAGTTGAACAAAAA
CTGTATTATATAAAATATTTAAGTCAAGATCAAAAGGATTTTGTTGTTGT
AGCCACTTCACGCCCTGAAACTATGTTTGGTGATAAATATTTAGTTATAA
ATCCTAAAGATAAACGTTATTTTCATTTACATAATAAAATTTTTATTAAT
CCAATTAATAATATAGAAATGACTGTTATTTTGGATGATTATATTGATAT
TGAATTTGGAACAGGAGTGATGAAGTGTACGCCTGCTCACGATTTTAATG
ACTATGAATTAGCTAAAAAACATAATTTAGAAATTATTAATATTATGAAC
GCTGATGGTACTTTAAATGAAAAATGTGGGGAATTTAAGGGTTTAGATCG
ATTAGAAGCTCGTTCTTTAATAATTGATAAATTACAGAAAAATAATCATT
TATTAAAAGTAGAATCTTATCGAACCAGCGTTGGTTTTAGTGAGAGAACT
AATGAAATTGTTGAACCTTATTTATCACATCAATGATTTATTAAAATGGA
TAGTTTAATAAAAGATACAATCAAAATGCAAGATGATTGTAATAATAAAG
TAGATTTTTATCCAAATCGTTTTAATAAGACTTTACTTACATGATTAAAA
AATACAGAAGATTGATGTATTTCAAGGCAATTATGATGAGGTCATCAGAT
ACCTGTTTGATATCATAAAAAAACTAATCAAATTTATTGTGACACTATTC
CCCCAAAGGATTTAGAAAATTGAATTCAGGATGAAGATGTTTTAGATACT
TGGTTTTCAAGTGGAATGTGACCTTTATTAACGACAAAATGAAATTATAA
TAGTCATTTTTTTGACCGTTATTTCCCTACATCTTTAATAGTTACAGGTA
TGGATATTTTATTTTTTTGAGTCTCAAGAATGATGAACTTTAGCCAATAT
TTGGTTGAAAAAAAACCTTTTAAGGATGTTTTAATTCATGGTTTAATTCG
TGATTCACAGGGACGTAAGATGTCAAAATCATTAGGGAATGGTATTGATC
CTTTTGACATTATTGATAAATATGGATTAGATGCTATGCGTTTATTTTTT
GCATCATGTACAACAATTGGTGAAGATTTAAATTTTTCAACAGAACGATT
AGGCGCTAATTGAAATTATTTAAATAAAATTTGAAATATTGCTAAATATA
TTGAAAATTTAGATGAAATTAACGATAATCTTAATTTTGAAGATGTTGAT
AAATTTTGTGACGTCAATAAATGAATATTGACTGAATTATCAAAATTAAC
CTTGGAAATTAATAAAAATATGGATAAATATAATCTAGTTGTTGCTACAA
AATATTTATATGATTTTATCTGAAATACTTTTGCGAGTTATTATTTAGAG
TACACAAAAGTTTTATTACAAGATTTAACATTAAAAAATGAAACAATTAA
AACAATTCGCTATGTATTTAATAAAATTTTAATCATGCTACAGCCTTTTG
CTCCTAATATTAGCGAAGAAATTTGATTATGTTTAAATCAAACAAATAAT
TCAATATTATTACAAGAATATCCAATAATTAATTTTGAGTTTGAAACAAT
AATTATAGATAAGATTGCGAAAATTATTTTAGAAATTAGAAAGCTACGAT
TAGAAGAAAATATTAATAATAGAATCAATCTTTGTTTTGAATTAATATCA
CCCAATGATGCATTTTATAAATCAAAGATAAAATTAGTTAATTTGTTATT
AATCTTAGTTAATGCTGAAATAAATGAAATTAAAAAAACAAGTTCTAATA
ATTATACTTATGAGCTAGTTATTGATGATTTTATTCTTAAAACTTCGTAT
GAAAAACCGATTGATTATGTTTTTCAAATGAAAAAAGCTAGTGAACAGTT
AAACTATTTGGAAAACGAAATTCAACGAGCAACTAATTTATTAAATAATT
CAGGTTTTATCAACAAAGCCCCTGCTCAATTAATAATTAAAGAAAAAAAT
AAATTAATTAATTTAAAAAAAGAACACGCAAATTTATTAAAAACTCTTAC
TGACTTAAAACAAAAGGTGAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy