Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR224 IGR221 IGR220 IGR223 IGR222 UU263 pacL, - UU264 UU265 UU262 UU260 valS, - UU267 UU263 pacL, - UU264 UU265 UU262 UU260 valS, - UU267 Type: tandem, Name:  - 154 Type: tandem, Name:  - 382 Type: tandem, Name:  - 153 Type: tandem, Name:  - 157 Type: tandem, Name:  - 151 Type: tandem, Name:  - 158 Type: tandem, Name:  - 156 Type: tandem, Name:  - 152 Type: tandem, Name:  - 445 Type: tandem, Name:  - 155 UU263 pacL, - UU264 UU262 UU260 valS, - UU267 UU261 UU266 UU265 UU261 UU266
* Calculated from Protein Sequence

Gene ID: UU264

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pacL  

Definition:
cation-transporting P-ATPase

Gene Start:
300525

Gene Stop:
297577

Gene Length:
2949

Molecular Weight*:
109954

pI*:
9.30

Net Charge*:
16.68

EC:
3.6.1.-  

Functional Class:
transport and binding proteins; cations  

Pathway: pathway table
Folate biosynthesis
Starch and sucrose metabolism

Comment:
See Prosite PDOC00139.

As this sequence contains similarity to ATPases, and it contains significant transmembrane regions, it is possible that this represents an export protein.

From: Molecular Biology and Pathogenicity of Mycoplasmas, Microbiology and Molecular Biology Reviews, Dec. 1998, p.1119.

Shmuel Razin, David Yogev, and Yehudith Naot

Generally, bacterial ABC importers have an ATP binding domain and membrane-spanning domains located on separate polypeptides whereas the ABC exporters may carry these components on the same or on different polypeptides.

Blast Summary:  PSI-Blast Search
Best hit to e323521 (Y13937) a putative PacL protein of B.subtilis.
Numerous hits to cation-transporting ATPase PacL proteins, e.g. residues 13-737 are 35% similar to (AE000873) of Methanobacterium thermoautotrophicum,) and residues 8-767 are 33% similar to ATCL_MYCGE.
UU264 is 34% similar to MG071, 26% similar to TP1036, and 24% similar to CT727, all of which are cation-transporting ATPases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0474 is EHgpCMYU.
Cog name: Cation transport ATPase.
Functional class: P.
BeTs to --g-cmyu.
Number of proteins in this genome belonging to this COG is 3



Blocks Summary:  Blocks Search
Residues 139-668 span six regions of similarity to blocks BL00154A-G which encompass E1-E2 ATPases phosphorylation site proteins.

ProDom Summary:  Protein Domain Search
Residues 8-179 are 36% similar to a defined domain of ATC_ARTSF, residues 262-353 are 55% similar to O59868_SCHPO, and residues 474-557 are 52% similar to ATCL_MYCGE, all of which are described as ATPase proteins.

Paralogs:  Local Blast Search
Residues 84-745 are 23% similar to UU203, a probable copper-transporting P-type ATPase.

Pfam Summary:  Pfam Search
Residues 1 to 67 (E-value = 1.5e-19) place UU264 in the Cation_ATPase_N family which is described as Cation transporter/ATPase, N-terminus (PF00690)
Residues 86 to 326 (E-value = 2.1e-88) place UU264 in the E1-E2_ATPase family which is described as E1-E2 ATPase (PF00122)
Residues 330 to 635 (E-value = 1.6e-20) place UU264 in the Hydrolase family which is described as haloacid dehalogenase-like hydrolase (PF00702)
Residues 731 to 922 (E-value = 1.1e-05) place UU264 in the Cation_ATPase_C family which is described as Cation transporting ATPase, C-terminus (PF00689)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
47  
68
transmembrane  
82  
98
non-globular  
176  
248
transmembrane  
249  
269
transmembrane  
278  
308
coil-coil  
381  
417
transmembrane  
673  
693
transmembrane  
697  
716
transmembrane  
748  
769
transmembrane  
819  
837
transmembrane  
859  
878
transmembrane  
897  
917
coil-coil  
934  
982

PDB Hit:


Gene Protein Sequence:
MSFDPENINPSTGLNDEQVLKSRQIYGFNEIKKKKKSHIITKFLKQFLDF
MVILLVIAAAVTLALVIIKPPHDTAELVVQYVEFGIICFILLLNAIFGTI
QEVKAEKNTDALSKLASHQVKVLRNNQIRIINSNQVVMGDVLILEAGDQV
PADALLVNSSSLEVDEAILTGESLPVVKNAKAIVKKNTVIGDCLNQIFSG
TYITNGTAKAIVTNIGMNTEIGKIAKLINDQKTKLTPLQKKINKLSKIIG
LFASILCIAVFIIYIYLIGDGNWNISWHPALIMAISLSIAAIPEGIVAIV
TIVLSFGIKEMAKQNALIKRLPAVETLGSANVICSDKTGTLTQNKMTVTK
VFTNKLKITDLIDNESVFNLIKWATIANNGIKNFNEKKQEYEFIGDPTET
CIIEAALKLNIDKYKLDQEFIRIHEFPFDSTRKLMSVVVKHQSDYYLITK
GAIDAIDKIVQNPITKDVYEANDFLSKQALRILCVAIKKLSSIPTNFNQD
ELEKCLEFVGLIGMIDPPRPETQEAVKIAIKAGIRPIMITGDHINTASAI
AKQVGILNEGQEVLNGNELNMMSDNELINNIDRYSVYARVSPTDKIRIVK
AWQHHDKVVSMTGDGVNDAPALKAADIGCAMGITGTDVSKASSDMILIDD
NFATIINAVSLGRSIMDNIKRIIVLLLITNLSGLVSLIFGIIILGINPMS
SLQILWINVIAETLPGIALGLHLADVNLMRHKPLKKSAPIVNKRMWATIF
TNGFFVGLISILLFYLGASSHFNFDFMLMRNEFKELTNLEKIYQDTWSWF
GQNHEISNIIHEKILTIKTAIMAGSSLTFVFMGMSLTFNALSLRTNHSVF
VNFWENCKYVVYSILISIVMIIVIAYTPHLNQIFNMNPYNINGYEWFNIL
PFVLFAIPLSIFEIIKYFRYLKLRSTFDYKNKTYALLNQEIQSTNLKINN
TKISYEKQYYKALLNNLIIKRKILINKCHKEI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCATTTGATCCAGAAAATATAAATCCATCAACAGGTCTAAATGATGA
GCAGGTTTTAAAAAGTCGTCAAATTTATGGTTTTAATGAAATCAAAAAGA
AAAAAAAATCCCACATTATTACAAAATTTTTAAAGCAGTTTTTAGATTTT
ATGGTTATTTTACTTGTAATCGCTGCTGCTGTTACTTTAGCTTTAGTGAT
TATTAAACCTCCTCATGATACAGCTGAATTAGTTGTTCAATATGTAGAAT
TTGGAATAATATGTTTTATTTTATTGTTAAATGCAATTTTTGGTACCATT
CAAGAAGTGAAAGCTGAAAAAAATACGGATGCATTGTCTAAATTAGCGTC
TCATCAGGTCAAAGTATTACGTAATAATCAAATTAGAATTATTAATTCTA
ACCAAGTTGTAATGGGTGATGTTTTGATTTTAGAAGCTGGTGATCAAGTC
CCAGCTGATGCTTTATTAGTGAACAGCTCATCACTTGAAGTAGATGAAGC
TATTTTAACAGGAGAATCTTTACCAGTTGTAAAAAATGCCAAGGCAATTG
TTAAAAAAAATACAGTAATTGGCGACTGTTTAAATCAAATTTTTTCTGGA
ACATATATTACTAATGGAACAGCAAAAGCAATTGTTACTAATATCGGTAT
GAATACTGAAATTGGTAAAATAGCCAAATTAATTAATGATCAAAAAACTA
AATTAACGCCTTTACAAAAAAAAATTAATAAGTTATCTAAAATTATAGGT
CTATTTGCTTCTATTTTATGTATTGCAGTATTTATTATTTATATTTATTT
AATTGGAGATGGAAATTGAAATATTAGTTGACATCCCGCTTTAATAATGG
CTATTTCATTATCTATAGCAGCTATTCCTGAAGGAATTGTGGCAATTGTA
ACAATTGTTTTATCATTCGGTATTAAAGAAATGGCAAAACAAAATGCTTT
AATTAAACGTTTGCCAGCTGTTGAAACTCTAGGAAGTGCTAATGTTATTT
GTTCTGATAAAACAGGAACCTTAACACAAAACAAAATGACTGTTACTAAA
GTTTTCACTAATAAATTAAAAATAACAGATTTAATTGATAATGAGAGTGT
TTTTAATTTAATTAAATGAGCTACTATAGCAAATAATGGAATTAAAAATT
TTAATGAAAAAAAACAAGAATATGAGTTTATTGGCGACCCTACAGAAACT
TGTATCATTGAAGCTGCTTTAAAATTAAACATAGATAAATATAAATTAGA
TCAAGAATTTATTAGAATTCATGAATTTCCATTTGATTCAACTCGAAAAT
TAATGAGTGTTGTTGTAAAACATCAAAGTGATTATTATTTAATTACTAAA
GGAGCAATTGATGCTATTGACAAAATTGTTCAAAATCCAATTACAAAAGA
TGTTTATGAAGCAAATGATTTTTTAAGTAAACAAGCTTTAAGAATTTTAT
GTGTTGCAATTAAAAAACTATCATCTATACCAACTAATTTTAACCAAGAT
GAACTTGAAAAATGTTTAGAATTTGTTGGTCTAATCGGTATGATAGATCC
GCCTCGTCCTGAAACACAAGAGGCAGTAAAAATTGCTATTAAAGCTGGAA
TCCGTCCGATAATGATTACTGGCGATCATATTAATACAGCATCAGCCATT
GCTAAACAAGTTGGTATTTTAAACGAAGGACAAGAAGTTTTGAATGGTAA
TGAATTGAATATGATGAGTGATAATGAATTAATAAATAATATTGATCGTT
ATAGTGTTTATGCCCGAGTTTCTCCAACAGATAAAATCCGTATTGTTAAA
GCTTGACAGCACCATGATAAAGTAGTAAGTATGACTGGAGATGGTGTCAA
TGATGCACCTGCACTAAAAGCTGCTGACATTGGATGCGCAATGGGTATAA
CTGGAACTGATGTTTCAAAAGCATCAAGTGATATGATATTAATTGATGAT
AATTTCGCAACAATTATTAATGCTGTTAGTTTAGGACGTTCTATTATGGA
CAACATTAAACGTATTATTGTTTTATTATTGATCACTAATTTATCTGGAT
TAGTTTCATTAATATTTGGAATTATTATTCTAGGAATTAATCCTATGTCA
TCACTACAAATATTATGAATTAATGTAATTGCTGAAACTTTACCTGGAAT
AGCATTAGGGTTACATTTAGCGGATGTTAATTTAATGCGACACAAACCAT
TAAAAAAATCAGCACCGATTGTTAATAAAAGAATGTGAGCTACTATTTTT
ACCAATGGTTTTTTTGTTGGTTTAATTTCTATTTTATTATTTTATTTAGG
AGCTTCTTCACACTTTAATTTTGACTTTATGCTAATGAGAAACGAGTTTA
AAGAACTTACTAATCTTGAAAAGATATATCAAGACACATGAAGTTGATTT
GGGCAAAATCACGAAATTTCCAATATTATTCATGAAAAAATTTTAACCAT
AAAAACAGCGATTATGGCTGGTTCGTCTTTAACATTTGTTTTTATGGGAA
TGAGCTTAACGTTTAATGCATTAAGCTTAAGAACAAATCATTCAGTATTC
GTTAATTTTTGAGAAAACTGTAAATACGTTGTTTATTCAATATTAATATC
AATAGTTATGATTATTGTTATCGCTTATACTCCTCATTTAAATCAAATAT
TCAATATGAATCCATACAACATAAACGGTTATGAGTGATTTAATATTCTT
CCATTTGTTCTTTTTGCAATACCTTTAAGTATTTTTGAAATTATCAAATA
TTTTAGATATTTAAAACTACGTAGTACTTTTGATTATAAAAATAAAACTT
ATGCATTATTAAACCAAGAAATACAATCAACAAATTTAAAAATTAATAAT
ACAAAAATTAGTTATGAAAAACAGTATTACAAGGCATTGTTGAATAATTT
AATTATTAAAAGAAAAATTTTAATAAATAAATGCCATAAAGAAATATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy