Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR205 IGR210 IGR204 IGR208 IGR207 IGR206 IGR215 IGR213 IGR211 IGR214 IGR212 IGR217 IGR216 IGR209 IGR218 rpmJ,rpL36, - UU254 rpS14, - UU244 infA, - UU253 rplQ,rpL17, - UU258 rpsK,rpS11, - UU256 rpL18,rplR, - UU247 rpS8, - UU245 rpsM,rpS13, - UU255 rpL15,rplO, - UU249 rplF,rpL6, - UU246 rpsE,rpS5, - UU248 kad,adk, - UU251 map, - UU252 rpoA, - UU257 secY, - UU250 UU259 rpmJ,rpL36, - UU254 rpS14, - UU244 infA, - UU253 rplQ,rpL17, - UU258 rpsK,rpS11, - UU256 rpL18,rplR, - UU247 rpS8, - UU245 rpsM,rpS13, - UU255 rpL15,rplO, - UU249 rplF,rpL6, - UU246 rpsE,rpS5, - UU248 kad,adk, - UU251 map, - UU252 rpoA, - UU257 secY, - UU250 UU259 Type: tandem, Name:  - 146 Type: tandem, Name:  - 143 Type: tandem, Name:  - 148 Type: tandem, Name:  - 144 Type: tandem, Name:  - 145 Type: tandem, Name:  - 147 infA, - UU253 rplQ,rpL17, - UU258 rpsK,rpS11, - UU256 rpL18,rplR, - UU247 rpS8, - UU245 rpsM,rpS13, - UU255 rpL15,rplO, - UU249 rplF,rpL6, - UU246 rpsE,rpS5, - UU248 kad,adk, - UU251 map, - UU252 rpoA, - UU257 secY, - UU250 UU259 rpmJ,rpL36, - UU254 rpS14, - UU244
* Calculated from Protein Sequence

Gene ID: UU252

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
map  

Definition:
methionine aminopeptidase

Gene Start:
287734

Gene Stop:
288483

Gene Length:
750

Molecular Weight*:
27913

pI*:
6.30

Net Charge*:
-3.97

EC:
3.4.11.18  

Functional Class:
translation; protein modification  

Pathway: pathway table

Comment:
See Prosite PDOC00417 and PDOC00575.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to methionine aminopeptidases, e.g. residues 1-248 are 42% similar to (AF036708) of Mycoplasma gallisepticum, and residues 10-248 are 30% similar to AMP1_YEAST.
UU252 is similar to MG172, CT851, and TP0842; all of which are methionine aminopeptidases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0024 is ehgpCmYu.
Cog name: Methionine aminopeptidase.
Functional class: J.
BeTs to e-g-cmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 89-110 represent block BL00680 (methionine aminopeptidase subfamily 1 proteins.)
Residues 164-176, 193-207, and 230-243 represent blocks BL00491B-D (Aminopeptidase P and proline dipeptidase proteins.)
Residues 64-82 and 89-126 represent blocks BL01202A-B (Methionine aminopeptidase subfamily 2 proteins.)

ProDom Summary:  Protein Domain Search
Residues 13-154 are 38% similar to a defined methionine aminopeptidase domain of AMPM_BACSU.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 163 to 238 (E-value = 6.3e-11) place UU252 in the Peptidase_M24 family which is described as metallopeptidase family M24 (PF00557)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
161

PDB Hit:
gi|6573394|pdb|1C27|A Chain A, E. Coli Methionine Aminopeptidase:norleucine Phosphonate Complex

Gene Protein Sequence:
MVIVKTEKDIAAIKEAVRIWKIAREAIYKQAKAGVSLKELDLLAKEVIEA
NGGIAAFHNYLGFKGHICISVNECVIHGVPTDYVLKDGDKVTFDVGVKYD
NHYCDAAFTIIINNSNVEALKISEICKKSIDEAVAIIKPKVTTHAISNAI
QKFIEKNGYFVLRDFAGHGCGNEIHEDPLIPNYRSLLYRNVTLEENMVIC
IEPMILSGSNAYYIDPNDQWSVKSKNHQMTCHWEHMILITKDGCEVLTD$


Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTATTGTTAAAACAGAAAAAGATATTGCTGCTATTAAAGAAGCTGT
GCGAATTTGAAAAATTGCTCGTGAAGCAATTTATAAACAAGCTAAAGCAG
GCGTTTCATTAAAAGAATTAGACTTATTAGCTAAAGAAGTTATTGAAGCA
AATGGTGGAATTGCTGCTTTTCACAACTATTTAGGTTTTAAAGGTCATAT
TTGTATTTCAGTGAATGAGTGCGTTATTCATGGAGTCCCAACCGATTACG
TCTTAAAAGATGGTGATAAGGTAACATTTGATGTTGGTGTTAAATACGAT
AATCATTATTGTGATGCGGCGTTTACCATTATTATTAACAACTCAAATGT
TGAAGCACTAAAAATATCAGAGATTTGTAAAAAATCAATTGACGAAGCCG
TTGCAATTATTAAACCAAAAGTAACAACACATGCAATTTCGAATGCAATT
CAAAAGTTTATTGAAAAAAACGGTTATTTTGTTCTTCGTGATTTTGCCGG
CCACGGTTGTGGTAATGAAATTCATGAAGATCCATTGATTCCTAATTATC
GATCTTTATTGTATCGTAATGTTACATTAGAAGAGAATATGGTAATTTGT
ATTGAACCAATGATTCTAAGTGGATCAAATGCTTATTATATTGATCCAAA
CGATCAATGATCTGTAAAATCTAAAAATCATCAAATGACTTGTCATTGAG
AACATATGATTCTAATTACAAAAGATGGTTGTGAAGTTTTAACAGATTAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy