Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR203 IGR210 IGR205 IGR204 IGR208 IGR202 IGR207 IGR206 IGR215 IGR213 IGR211 IGR214 IGR217 IGR212 IGR216 IGR209 IGR218 rpmJ,rpL36, - UU254 rpS14, - UU244 infA, - UU253 rpL24, - UU242 rplQ,rpL17, - UU258 rpsK,rpS11, - UU256 rpL18,rplR, - UU247 rpsM,rpS13, - UU255 rpS8, - UU245 rpL15,rplO, - UU249 rplF,rpL6, - UU246 rpL5, - UU243 rpsE,rpS5, - UU248 kad,adk, - UU251 map, - UU252 rpoA, - UU257 secY, - UU250 UU259 rpmJ,rpL36, - UU254 rpS14, - UU244 infA, - UU253 rpL24, - UU242 rplQ,rpL17, - UU258 rpsK,rpS11, - UU256 rpL18,rplR, - UU247 rpsM,rpS13, - UU255 rpS8, - UU245 rpL15,rplO, - UU249 rplF,rpL6, - UU246 rpL5, - UU243 rpsE,rpS5, - UU248 kad,adk, - UU251 map, - UU252 rpoA, - UU257 secY, - UU250 UU259 Type: tandem, Name:  - 145 Type: tandem, Name:  - 142 Type: tandem, Name:  - 143 Type: tandem, Name:  - 144 Type: tandem, Name:  - 146 infA, - UU253 rplQ,rpL17, - UU258 rpsK,rpS11, - UU256 rpL18,rplR, - UU247 rpsM,rpS13, - UU255 rpS8, - UU245 rpL15,rplO, - UU249 rplF,rpL6, - UU246 rpL5, - UU243 rpsE,rpS5, - UU248 kad,adk, - UU251 map, - UU252 rpoA, - UU257 secY, - UU250 UU259 rpmJ,rpL36, - UU254 rpL24, - UU242 rpS14, - UU244
* Calculated from Protein Sequence

Gene ID: UU251

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
kad  adk  

Definition:
adenylate kinase

Gene Start:
287068

Gene Stop:
287709

Gene Length:
642

Molecular Weight*:
24316

pI*:
7.90

Net Charge*:
2.25

EC:
2.7.4.3  

Functional Class:
purines, pyrimidines, nucleosides, and nucleotides; purines  

Pathway: pathway table
Purine metabolism

Comment:
See Prosite PDOC00104.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to adenylate kinases, e.g. residues 1-210 are 41% similar to KAD_MYCCA, and residues 1-209 are 38% similar to KAD_BACSU. Also several hits to eukaryotic sequences including KAD3_HUMAN, KAD3_RAT, KAD3_BOVIN, KAD2_HUMAN, and KAD1_YEAST.
UU251 is similar to MG171, CT128, and TP0595, all of which represent adenylate kinases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0563 is ehgpCmYu.
Cog name: Adenylate/cytidylate kinase.
Functional class: F.
BeTs to e-g-c-yu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 4-185 span six regions of similarity to blocks BL00113A-D, which encompass adenylate kinase proteins.

ProDom Summary:  Protein Domain Search
Residues 1-172 are 36% similar to a defined adenylate kinase domain of KAD_ECOLI.
Residues 126-205 are 44% similar to a defined adenylate kinase domain of KAD_MYCCA.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 5 to 188 (E-value = 1.8e-47) place UU251 in the ADK family which is described as Adenylate kinase (PF00406)
Residues 124 to 159 (E-value = 6.5e-19) place UU251 in the ADK_lid family which is described as Adenylate kinase, active site lid (PF05191)

PDB Hit:
gi|2392647|pdb|1ZIN| Adenylate Kinase With Bound Ap5a

Gene Protein Sequence:
MKILLIGPPGSGKGSVSELLTKNNTLKHVSTGNLFRAILKEDSELARKIK
EINVSGGKLVPDEITNQVAKSAIDELIKNEQSFILDGYPRTINQALALEQ
YCNLDYIFYLDIDHQELMKRLTGRWMCPKCAGIYNIHFKKPQVHGLCDND
QATLYQRADDHADAVSIRLDEYDKLTLPLIKHYETNPRFIKINANQPIED
VYKNINNYLKQNK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATCCTTTTAATTGGCCCCCCAGGGAGTGGTAAGGGAAGTGTTAG
TGAATTATTAACTAAAAATAATACATTAAAACATGTTTCCACAGGTAATT
TATTTCGTGCAATTCTAAAAGAGGATAGCGAATTAGCACGTAAAATTAAA
GAGATTAATGTTTCTGGTGGTAAATTAGTACCAGATGAAATTACTAATCA
AGTTGCTAAATCAGCAATTGATGAATTAATTAAAAATGAACAATCATTTA
TTTTAGATGGTTATCCACGCACAATTAATCAAGCCTTAGCATTAGAACAA
TATTGTAATTTAGATTATATTTTTTATCTAGATATTGATCATCAAGAATT
AATGAAACGTTTAACTGGGCGTTGAATGTGCCCAAAATGTGCAGGAATTT
ATAATATTCATTTTAAAAAACCACAAGTTCATGGTTTATGTGACAATGAT
CAAGCTACTCTTTATCAACGAGCTGATGATCATGCAGATGCTGTAAGTAT
TCGATTAGATGAATATGATAAATTAACCCTACCTTTGATTAAGCATTATG
AAACTAATCCACGTTTTATTAAAATCAATGCTAATCAACCTATTGAAGAT
GTTTATAAAAACATTAACAATTATTTAAAACAAAATAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy