Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR181 IGR180 IGR182 IGR179 IGR184 IGR183 xerC, - UU222 UU224 UU220 amt, - UU218 fthS, - UU221 amt, - UU219 xasA, - UU223 xerC, - UU222 UU224 UU220 amt, - UU218 fthS, - UU221 amt, - UU219 xasA, - UU223 Type: tandem, Name:  - 404 Type: tandem, Name:  - 138 Type: tandem, Name:  - 139 Type: tandem, Name:  - 381 xerC, - UU222 UU224 UU220 amt, - UU218 fthS, - UU221 amt, - UU219 xasA, - UU223
* Calculated from Protein Sequence

Gene ID: UU221

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fthS  

Definition:
formate-tetrahydrofolate ligase

Gene Start:
265321

Gene Stop:
266886

Gene Length:
1566

Molecular Weight*:
58456

pI*:
7.30

Net Charge*:
1.99

EC:
6.3.4.3  

Functional Class:
central intermediary metabolism; one carbon metabolism  

Pathway: pathway table
Folate biosynthesis
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate

Comment:
Formate--tetrahydrofolate ligase is one of the enzymes participating in the transfer of
one-carbon units, an essential element of various biosynthetic pathways.

See Prosite PDOC00595.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to formate-tetrahydrofolate ligases, e.g. residues 17-515 are 37% similar to FTMS_CLOAC of Clostridium acidi-urici. Also similar to formate-tetrahydrofolate ligases of Streptococcus mutans and Clostridium cylindrosporum.
Significant number of matches to eukaryotic FTHS proteins. UU221 shows no significant similarity to T.pallidum, C.trachomatis, or M.genitalium.

COGS Summary:  COGS Search
No COG found in manual search. The following found automatically:

The phylogenetic pattern of is Eh--CM-U.
Cog name: (Predicted) ATPases involved in pili biogenesis.
Functional class: N.
BeTs to ------y-.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 24-521 span ten regions of similarity to blocks BL00721A-F, H-I, which encompass
formate tetrahydrofolate ligases, e.g. FTHS_CLOTH.



ProDom Summary:  Protein Domain Search
Residues 17-515 constitute a domain of FTHS_CLOAC, a formate-tetrahydrafolate ligase.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 1 to 518 (E-value = 5.6e-139) place UU221 in the FTHFS family which is described as Formate--tetrahydrofolate ligase (PF01268)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
78

PDB Hit:


Gene Protein Sequence:
MAKIIEEMINKKGLLIDDYELYGNEIAKIKSIKKLNKKDSKLIVITSMNP
NPAGEGKTTTAIGLVDALNKHGYKAIGALREPSMGPVFGMKGTGSGGGLS
FLKPFDKINLHFSGDFHAITAANNLIVAVIENEIHNRSSMQIDSQKILIK
RCLDVNDRSLRNIEYDINHQQTKSGFNITAASDLMALFCLAHDHKDFEDK
LAQTIVAYNIVNQPIRICDLELTKAIMAILEDALYANLVRTNEDNPVFVH
GGPFANIAHGCNSIIATKNALALGDYVVTECGFGSDLGLEKFMNIKMASL
NLKPDLIGLVISLKSIAYHAQTNEKDYVKQGFANVLCHINHIKKYNVSFI
VYINVNTNTDSEEDLLTLEKLLDEHQIEHARSYAYSYGSKKSEEITKKTI
TLTNQINDHELKLIYDIKDHLSYKLKKICENVYGADGYELSYEAKEQLNR
YEHLDFYLCIAKTPYSISDDAKLLNNPKNFKIHIERFEINYAAKLIIAIT
TTIYRMPGLNKEPAAKNFVMK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAAAATTATTGAAGAAATGATTAATAAAAAAGGGTTGTTAATTGA
TGATTATGAACTTTATGGCAATGAGATTGCTAAAATTAAATCAATTAAAA
AACTAAATAAAAAGGATTCAAAATTAATTGTTATTACCTCAATGAATCCT
AATCCAGCTGGTGAAGGTAAAACAACAACTGCTATTGGTTTAGTTGATGC
TTTAAATAAACATGGATACAAAGCAATTGGAGCCTTACGAGAGCCATCAA
TGGGACCAGTTTTTGGTATGAAAGGTACGGGTTCTGGAGGAGGATTATCT
TTTTTAAAACCCTTTGATAAAATTAATTTACATTTTAGTGGTGATTTCCA
TGCGATTACTGCAGCTAATAATTTAATCGTTGCAGTAATAGAAAATGAAA
TACATAATAGGTCTTCAATGCAAATCGATTCTCAAAAAATTTTAATTAAA
AGATGTCTAGATGTTAATGATCGTTCTTTACGTAATATTGAATATGATAT
TAACCATCAACAAACAAAAAGTGGTTTCAACATTACAGCAGCGAGTGATT
TAATGGCATTATTTTGTTTAGCACATGATCATAAAGATTTTGAAGATAAA
CTTGCGCAAACAATTGTTGCATATAATATAGTAAACCAACCTATAAGAAT
TTGTGATTTAGAATTAACAAAAGCTATTATGGCAATTTTAGAAGATGCTT
TATATGCTAATTTAGTACGAACTAATGAGGATAACCCTGTTTTTGTTCAT
GGTGGCCCATTTGCTAATATTGCTCATGGTTGTAATAGTATTATTGCAAC
CAAAAATGCTTTAGCTTTAGGTGATTATGTTGTTACTGAATGTGGTTTTG
GTAGCGATTTAGGACTTGAAAAATTTATGAATATCAAGATGGCTAGTTTG
AATTTAAAACCAGATTTAATTGGTTTAGTTATTAGTCTAAAATCAATCGC
ATATCATGCTCAAACAAACGAAAAAGACTACGTTAAACAAGGCTTTGCTA
ATGTTTTATGTCATATTAATCACATTAAAAAATATAATGTTTCTTTTATT
GTTTATATTAATGTCAATACTAATACTGATAGCGAAGAAGACTTATTAAC
TTTAGAAAAACTATTAGATGAACATCAAATTGAACATGCACGTTCTTATG
CTTATAGCTATGGTTCTAAAAAAAGTGAAGAAATAACTAAAAAAACAATT
ACTTTAACTAATCAAATTAATGATCATGAATTAAAATTAATTTATGATAT
TAAAGATCATTTATCATATAAATTAAAAAAAATATGTGAAAATGTTTATG
GTGCTGATGGATATGAATTAAGCTATGAAGCTAAAGAACAATTGAATCGT
TATGAACATTTAGATTTTTATTTATGCATTGCTAAAACACCATATTCAAT
TTCTGATGATGCAAAATTATTAAATAATCCTAAGAACTTTAAAATTCATA
TTGAACGCTTTGAAATTAATTATGCTGCAAAATTAATCATTGCTATTACA
ACAACTATTTATCGTATGCCTGGCTTAAATAAAGAACCAGCGGCCAAAAA
TTTCGTTATGAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy