Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR175 IGR176 IGR181 IGR180 IGR177 IGR178 IGR179 ptc1, - UU215 UU217 UU214 pkn, - UU216 UU220 amt, - UU218 fthS, - UU221 amt, - UU219 ptc1, - UU215 UU217 UU214 pkn, - UU216 UU220 amt, - UU218 fthS, - UU221 amt, - UU219 Type: tandem, Name:  - 138 Type: tandem, Name:  - 135 Type: tandem, Name:  - 136 Type: tandem, Name:  - 137 ptc1, - UU215 UU217 UU214 pkn, - UU216 UU220 amt, - UU218 fthS, - UU221 amt, - UU219 gmk, - UU213 gmk, - UU213
* Calculated from Protein Sequence

Gene ID: UU218

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
amt  

Definition:
ammonium transporter

Gene Start:
260648

Gene Stop:
262180

Gene Length:
1533

Molecular Weight*:
54687

pI*:
8.60

Net Charge*:
5.27

EC:
 

Functional Class:
transport and binding proteins; ammonium  

Pathway: pathway table

Comment:
In B.subtilis, two genes make up the NRG operon (A and B). UU218 and UU219 are possibly NRGA proteins. Neither NRGB_BACSU nor GLNB_ECOLI have significant similarities to UU proteins.

From: Molecular Biology and Pathogenicity of Mycoplasmas, Microbiology and Molecular Biology Reviews, Dec. 1998, p.1118-1119.Shmuel Razin, David Yogev, and Yehudith Naot.

The dependence of ureaplasmas on urea for growth has led to the hypothesis that intracellular urea hydrolysis and the resulting intracellular accumulation of ammonia/ammonium ions is coupled to ATP synthesis through a chemiosmotic type of mechanism. Experimental support for the generation of a transmembrane potential, with resultant ATP synthesis through the ureaplasmal F0F1-type ATPase, first provided by Romano et al. (1986, Medline: 3797330) was more recently extended and confirmed by Smith et al. (1993, Medline: 8501029) [...] It is worth mentioning at this point that the pH of the urogenital tract is usually on the acidic side of neutrality, corresponding to the pH values optimal for ureaplasma growth, maximum increase in delta P, maximum ammonia chemical potential, maximum urease activity, and maximum ATP generation.

See UU219, a predicted ammonium transporter sequence.
See UU427-UU434 for predicted urease components.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to ammonium transporter proteins, e.g. residues 40-463 are 37% similar to NRGA_BACSU.
U218 shows no significant similarities to T.pallidum, C.trachomatis, or M.genitalium sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of is e---CMY-.
Cog name: Ammonia permeases.
Functional class: P.
BeTs to e---cmy-.
Number of proteins in this genome belonging to this COG is 2



Blocks Summary:  Blocks Search
Residues 46-74, 206-234, 45-73, 154-188, 310-344, 211-236, 247-270, 254-277, 324-333, 368-392, and 442-463 represent blocks BL01219A-G (ammonium transporter proteins)

ProDom Summary:  Protein Domain Search
Residues 208-463 constitute domains of Y661_METTH, a transmembrane ammonium transporter.
Residues 141-202 are 51% similar to O67997_AZOBR, another transmembrane ammonium transporter.

Paralogs:  Local Blast Search
UU218 is isologously related to UU219; residues 1-499 are 75% similar to UU219.

Pfam Summary:  Pfam Search
Residues 48 to 463 (E-value = 7.2e-97) place UU218 in the Ammonium_transp family which is described as Ammonium Transporter Family (PF00909)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
45  
67
transmembrane  
85  
106
transmembrane  
139  
170
transmembrane  
180  
204
transmembrane  
208  
231
transmembrane  
252  
270
transmembrane  
283  
306
transmembrane  
323  
357
transmembrane  
414  
440

PDB Hit:


Gene Protein Sequence:
VRIVSTIITTSWGVDPNIYFSKHELTWVPATADANTLALTNFNPTSTLLV
ALAIAFVLLMTPGLALFYGGLTRRKSTLTIINQCVASLGITTLIWIFGGF
SLAFGPSVGKGIIGDISTYFAFRNLLFADGWSGDVGIVFANFTNGVPLIL
FFAYQLAFAIITPPLMVGAFADRMKFKNYLVFLVLWQYLIYIPFAHWIWG
QGFLAAAGVIDFAGGIVIHTTAGFGALAASLVLGKRVLLKNDKSRPHNIP
MTIIGATLLFFGWFGFNVGGSGFVAGGNAATWSAATSAWINTIIALAIGM
VGWAVLETIFNKNHKATGVGLVTGAIAGLATITPAAGYVPIWASVPIGVA
AVLVCYTSAKTLHHFHKIDDTLEVWGVHGMGGVTGSLLIGAFASKSVNPS
IMYEAIGPTTTGVLFGVQLGAVLLAAVYGFVFTILLVYITRPRLSARQQL
GHIDYINHGEDAYSFDIEIPSEKEMEQYELADSTWHSSTGVKYSLLNNKN
QQNHKVANDH$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAGAATTGTGTCAACAATTATAACTACATCTTGAGGAGTAGATCCAAA
TATTTACTTTTCAAAGCATGAGTTAACATGAGTGCCAGCAACAGCTGATG
CTAATACATTAGCATTAACTAATTTTAATCCGACTAGCACTTTATTAGTT
GCATTAGCAATTGCCTTTGTCTTATTGATGACTCCAGGTTTAGCATTATT
TTATGGTGGGCTAACACGTCGAAAATCTACATTAACGATTATTAATCAAT
GTGTAGCTTCACTTGGAATCACAACACTGATTTGAATTTTTGGAGGGTTC
TCACTTGCTTTTGGACCTTCTGTTGGTAAAGGAATAATTGGTGATATTTC
AACTTATTTTGCATTTAGAAATCTATTATTTGCTGATGGTTGAAGTGGAG
ATGTAGGAATTGTTTTTGCAAACTTTACTAATGGTGTACCATTAATTTTA
TTCTTTGCTTATCAATTAGCTTTTGCAATTATTACACCACCATTAATGGT
TGGTGCATTTGCAGATCGAATGAAATTTAAAAATTATCTAGTATTCTTAG
TACTATGACAATATTTAATTTACATTCCTTTTGCACATTGAATTTGAGGT
CAAGGATTCTTAGCTGCTGCTGGAGTAATTGACTTTGCTGGTGGTATTGT
AATTCATACAACTGCTGGTTTTGGAGCATTAGCTGCTTCATTAGTATTAG
GTAAACGTGTTTTACTTAAGAATGATAAAAGTCGTCCACACAATATTCCA
ATGACTATTATTGGAGCAACATTGTTATTCTTTGGTTGATTTGGATTTAA
TGTTGGTGGATCAGGATTTGTAGCTGGTGGGAATGCTGCTACTTGATCAG
CTGCTACAAGTGCTTGGATTAATACAATTATTGCTTTAGCTATTGGAATG
GTTGGTTGAGCAGTTCTTGAAACAATCTTTAATAAAAATCATAAAGCCAC
AGGTGTTGGTTTAGTAACAGGTGCAATTGCTGGATTAGCAACAATTACTC
CTGCAGCAGGTTATGTTCCAATTTGAGCATCTGTTCCTATTGGTGTAGCT
GCTGTGCTAGTTTGTTATACTAGTGCTAAAACTTTACATCATTTCCACAA
AATTGATGATACTCTAGAAGTATGAGGCGTACATGGAATGGGTGGTGTTA
CTGGTTCATTATTAATTGGTGCGTTTGCATCTAAATCTGTAAACCCATCA
ATTATGTATGAAGCAATTGGTCCAACAACAACTGGTGTTTTATTTGGTGT
CCAATTAGGAGCGGTTTTATTAGCTGCGGTTTATGGATTTGTATTTACTA
TTTTATTAGTATATATTACTCGTCCAAGATTATCAGCACGCCAACAATTA
GGTCATATAGACTATATTAATCATGGCGAAGATGCATATTCATTCGATAT
TGAAATTCCATCTGAAAAAGAAATGGAGCAATATGAATTAGCAGATAGTA
CATGACACTCAAGCACAGGTGTTAAGTATTCATTGCTTAATAATAAAAAC
CAGCAAAATCATAAAGTAGCAAACGACCATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy