Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR175 IGR176 IGR173 IGR172 IGR180 IGR177 IGR178 IGR179 IGR174 rpL27, - UU210 rpL21, - UU212 UU211 ptc1, - UU215 UU217 UU214 pkn, - UU216 UU220 amt, - UU218 amt, - UU219 rpL27, - UU210 rpL21, - UU212 UU211 ptc1, - UU215 UU217 UU214 pkn, - UU216 UU220 amt, - UU218 amt, - UU219 Type: tandem, Name:  - 138 Type: tandem, Name:  - 135 Type: tandem, Name:  - 136 Type: tandem, Name:  - 137 UU211 rpL21, - UU212 rpL27, - UU210 ptc1, - UU215 UU217 UU214 pkn, - UU216 UU220 amt, - UU218 amt, - UU219 gmk, - UU213 gmk, - UU213
* Calculated from Protein Sequence

Gene ID: UU217

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
259723

Gene Stop:
260511

Gene Length:
789

Molecular Weight*:
29988

pI*:
10.00

Net Charge*:
11.73

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to conserved hypothetical proteins, e.g. 3844699, and Y110_MYCGE, both from M.genitalium.
Residues 1-245 are 37% similar to e323525 (Y13937) from B.subtilis, corresponding to YloQ protein.
Also similar to MG110, a conserved hypothetical protein from M.genitalium. No similarity to C.trachomatis or T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of is EHGPCMYU.
Cog name: Predicted GTPase.
Functional class: R.
BeTs to -hg-c---.
Number of proteins in this genome belonging to this COG is 6



Blocks Summary:  Blocks Search
Residues 120-141 represent block PR00449A (transforming protein p21 ras signature)

ProDom Summary:  Protein Domain Search
Residues 99-242 constitute a domain of O34530_BACSU. Residues 3-89 constitute a defined domain of O66556_AQUAE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 94 to 243 (E-value = 1.6e-55) place UU217 in the DUF258 family which is described as Protein of unknown function, DUF258 (PF03193)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
140

PDB Hit:
None.

Gene Protein Sequence:
MVGDDVEVELIGNTYLITKIYERYNQLIRPKVANIDIVLIVVSIVQPDLN
TLSLNKYLAFYEARNIKNVLIGLSKYDLANNHLKQKINKLILDYKKNNYA
VFILTKENDILLLKEKIKSKTLCLAGNSGVGKSTLINKLDPSIQQRTQEI
SHFLNRGKHTTTSTKLISFANGFLVDTPGFGNLEVNLTKNEMANAFNDFA
NYARFCKFSNCLHIEEPECAIKKAVDEKLIVNWRYDDYLKIIKELPNDVL
KIKTRAQNRKCK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTGGGGATGATGTTGAAGTTGAATTAATTGGGAATACTTATTTAAT
CACAAAAATTTATGAACGTTATAATCAATTAATTCGTCCCAAAGTTGCAA
ATATTGATATTGTTTTAATCGTAGTCTCTATTGTACAACCAGATTTAAAT
ACATTGAGTTTAAACAAATATTTAGCTTTTTATGAAGCTCGCAATATTAA
AAATGTTTTAATAGGTTTGAGTAAATATGATTTAGCCAATAATCATTTAA
AACAAAAAATTAATAAGTTAATTTTAGATTATAAAAAAAATAACTATGCG
GTTTTTATATTAACAAAAGAAAATGATATTTTATTATTAAAAGAAAAGAT
TAAAAGCAAGACACTTTGTTTGGCAGGAAATTCAGGCGTAGGTAAATCAA
CATTAATTAATAAATTAGATCCAAGCATTCAACAACGTACACAGGAAATA
TCACATTTTCTGAATCGAGGAAAACACACAACAACAAGTACCAAACTAAT
TAGTTTTGCTAATGGCTTTTTAGTTGATACACCGGGTTTTGGAAATTTAG
AGGTTAATTTAACCAAGAATGAAATGGCTAATGCCTTTAATGATTTTGCA
AATTATGCACGTTTTTGTAAATTTTCTAATTGTTTACATATTGAAGAACC
AGAATGTGCTATTAAAAAAGCTGTTGATGAAAAATTAATTGTTAATTGAC
GATATGATGACTATTTAAAAATAATAAAAGAATTACCAAATGATGTGTTG
AAAATAAAAACACGTGCTCAAAATAGAAAATGTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy