Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR175 IGR172 IGR173 IGR176 IGR170 IGR180 IGR177 IGR178 IGR179 IGR174 IGR171 rpL27, - UU210 rpL21, - UU212 UU211 UU209 rpL28, - UU209.1 ptc1, - UU215 UU217 UU214 pkn, - UU216 amt, - UU218 amt, - UU219 rpL27, - UU210 rpL21, - UU212 UU211 UU209 rpL28, - UU209.1 ptc1, - UU215 UU217 UU214 pkn, - UU216 amt, - UU218 amt, - UU219 Type: tandem, Name:  - 135 Type: tandem, Name:  - 136 Type: tandem, Name:  - 137 UU211 UU209 rpL27, - UU210 rpL21, - UU212 rpL28, - UU209.1 ptc1, - UU215 UU217 UU214 pkn, - UU216 amt, - UU218 amt, - UU219 gmk, - UU213 gmk, - UU213
* Calculated from Protein Sequence

Gene ID: UU216

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pkn  

Definition:
serine-threonine protein kinase

Gene Start:
258437

Gene Stop:
259597

Gene Length:
1161

Molecular Weight*:
45229

pI*:
7.60

Net Charge*:
1.90

EC:
2.7.1.-  

Functional Class:
translation; protein modification  

Pathway: pathway table
Inositol phosphate metabolism
Nicotinate and nicotinamide metabolism
Sphingoglycolipid metabolism
Starch and sucrose metabolism

Comment:
See Prosite: PDOC00100, PDOC00212, PDOC00213, PDOC00629

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to serine/threonine-protein kinases, e.g. residues 1-358 are 28% similar to PKNS_MYCGE.
UU216 is similar to MG109 from M.genitalium, CT673, and CT301 from C.trachomatis. All of which are probable serine/threonine kinases. No similarity to T.pallidum.


COGS Summary:  COGS Search
The phylogenetic pattern of is --gpCmY-.
Cog name: Serine/threonine protein kinase.
Functional class: R.
BeTs to --g-c-y-.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 113-131 and 296-314 show significant correspondence 99.65% of blocks PR00495A,B (obesity factor leptin signature)
Residues 150-170 and 229-244 show 97% correspondence to blocks BL00107A,B (protein kinases ATP-binding proteins)

ProDom Summary:  Protein Domain Search
Residues 98-290 constitute a defined domain of PKNS_MYCPN, a kinase protein transferase.
Residues 292-378 are 36% similar to a defined domain of PKNS_MYCGE, a serine/threonine-protein kinase.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 15 to 309 (E-value = 3.7e-27) place UU216 in the Pkinase family which is described as Protein kinase domain (PF00069)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
359  
382

PDB Hit:
gi|5542491|pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin

Gene Protein Sequence:
MREEIKTNSILNYKYKVVKHLADGGFSKVYLCCFLSDETKFIVIKVLDIN
DEKQQMVVYDELRISNLIKNSDSDKKNYIMEYYEYFETGSLENNDKRIYI
VFEYIEGLTLREYLDEFKTITYVKAVEIIRQVALGVSFFHSCNPQIIHRD
LKPENCMINKTLTKIKIIDYGAASVFYNREDLTKDQEIKCTIIYASPKLL
SLGQKVKEQANKGLNKRALSLINDALGVSYDIHSLGVMLYELITGTNPFS
EHTITDDRDYLEKWITYDVEPLSLINKTIPKGIDNILMRCFAWKKEDNKL
LYKDIYTLIDDLSNVMDPESNLNQEYIKPLNKLRIYRKNLAGLYEIKEKD
RKWYLQKWFIILISCLSVILIILLIIILFFKKSGAI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTGAAGAAATAAAAACAAACTCAATTCTTAATTATAAATATAAAGT
TGTTAAACACCTAGCAGATGGTGGTTTTAGTAAAGTTTATTTATGTTGTT
TTTTATCAGATGAAACTAAGTTTATTGTTATTAAAGTTTTAGATATTAAT
GATGAGAAACAACAAATGGTTGTTTATGATGAATTAAGAATTTCAAATTT
AATTAAAAATTCTGATTCTGATAAAAAAAACTATATTATGGAATATTATG
AATATTTTGAAACCGGTTCGTTAGAAAATAATGATAAAAGGATTTATATT
GTTTTTGAATACATTGAAGGTTTGACATTGCGTGAATATCTTGATGAATT
TAAAACAATTACTTATGTTAAGGCTGTTGAAATTATTCGTCAGGTTGCCT
TAGGTGTAAGTTTTTTTCATAGTTGTAATCCACAAATTATTCATCGTGAT
TTAAAGCCAGAAAATTGCATGATTAATAAAACCTTAACAAAAATTAAAAT
TATTGATTATGGTGCAGCATCGGTTTTTTACAATCGTGAAGATTTAACAA
AAGATCAAGAAATTAAATGTACAATTATTTACGCTTCACCAAAATTATTA
AGTCTTGGGCAAAAAGTTAAAGAACAAGCTAATAAGGGTTTAAATAAAAG
AGCTTTAAGTTTAATTAATGACGCATTAGGTGTTAGTTATGATATTCATT
CTTTAGGAGTTATGTTATATGAATTAATTACTGGAACTAACCCTTTTAGT
GAACATACAATTACAGATGATCGTGATTATTTAGAAAAATGAATAACATA
TGATGTTGAACCACTATCGTTAATTAATAAAACAATACCAAAAGGTATTG
ATAATATTTTAATGCGTTGTTTTGCTTGAAAAAAAGAAGATAATAAGTTG
TTATACAAAGATATCTACACTTTAATTGATGATTTAAGTAATGTTATGGA
TCCAGAGTCAAATCTTAATCAAGAATACATTAAACCATTAAATAAGTTAC
GAATTTATCGTAAAAATCTAGCAGGCTTATATGAAATTAAAGAAAAAGAT
CGTAAATGATATTTACAAAAATGATTTATTATTCTTATTAGTTGTTTATC
GGTTATTCTAATCATTTTATTAATTATTATTTTATTTTTTAAAAAAAGTG
GGGCAATCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy