Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR175 IGR176 IGR173 IGR172 IGR168 IGR170 IGR169 IGR177 IGR178 IGR179 IGR174 IGR171 UU208 rpL27, - UU210 rpL21, - UU212 UU211 UU209 UU207 rpL28, - UU209.1 ptc1, - UU215 UU217 UU214 pkn, - UU216 amt, - UU218 amt, - UU219 UU208 rpL27, - UU210 rpL21, - UU212 UU211 UU209 UU207 rpL28, - UU209.1 ptc1, - UU215 UU217 UU214 pkn, - UU216 amt, - UU218 amt, - UU219 Type: tandem, Name:  - 136 Type: tandem, Name:  - 133 Type: tandem, Name:  - 427 Type: tandem, Name:  - 134 Type: tandem, Name:  - 135 Type: tandem, Name:  - 137 UU211 UU209 UU207 UU208 rpL27, - UU210 rpL21, - UU212 rpL28, - UU209.1 ptc1, - UU215 UU217 UU214 pkn, - UU216 amt, - UU218 amt, - UU219 gmk, - UU213 gmk, - UU213
* Calculated from Protein Sequence

Gene ID: UU215

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ptc1  

Definition:
protein phosphatase

Gene Start:
257688

Gene Stop:
258431

Gene Length:
744

Molecular Weight*:
28307

pI*:
5.70

Net Charge*:
-3.89

EC:
3.1.3.-  3.1.3.16  

Functional Class:
translation; protein modification  

Pathway: pathway table
Aminosugars metabolism
Nicotinate and nicotinamide metabolism
Riboflavin metabolism
Thiamine metabolism
Vitamin B6 metabolism

Comment:
See Prosite PDOC00792

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to putative protein phosphatase sequences, e.g. residues 3-242 are 33% similar to PPH_MYCPN.
UU215 is also similar to MG108 of M.genitalium, a suspected protein phosphatase 2C homolog, and similar to CT259 of C.trachomatis, a probable protein phosphatase.


COGS Summary:  COGS Search
The phylogenetic pattern of is --gpC-Y-.
Cog name: Protein serine/threonine phosphatase.
Functional class: R.
BeTs to ---pc-y-.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
None

ProDom Summary:  Protein Domain Search
Residues 3-146 constitutes a defined domain of PPH_MYCPN, a protein phosphatase. Residues 150-242 support this assignment.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 2 to 240 (E-value = 8.6e-05) place UU215 in the PP2C family which is described as Protein phosphatase 2C (PF00481)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
206  
234

PDB Hit:
None.

Gene Protein Sequence:
MNFGFISDIGSQRKHNDDCALVIQNQYQQTLLIVCDGLGGYKGGAAASHI
TLETIKDNFLTTDFSEYDKQQIQKWYIKVIKLAQVEIDRTVLLDKDVYNM
GTTVVASIVVNDFSYTLNIGDSRAYLLSNEQFLQISRDHNLLQVLQERKA
NPEVYKKHEKNLFSLTQFVGRTSNIFLSYDLFVNKLNPNEIIVLTSDGFH
NYFELNTLYEKLIKSTQETKNELLQQLIRQAIINGSNDNLSLAFLIF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATTTTGGGTTTATTAGTGATATTGGCTCACAACGCAAACATAATGA
TGATTGTGCATTGGTAATTCAAAATCAATATCAACAAACTTTATTAATTG
TTTGTGATGGATTAGGCGGGTATAAAGGTGGTGCTGCGGCTAGCCACATT
ACATTAGAAACAATTAAAGATAATTTTTTAACTACAGATTTTAGTGAGTA
TGATAAACAACAGATTCAAAAATGGTATATTAAAGTTATTAAACTAGCAC
AGGTTGAAATTGATCGCACTGTTTTACTAGATAAAGACGTTTATAATATG
GGAACTACAGTTGTTGCTTCTATTGTTGTTAATGATTTTTCATACACTCT
AAATATTGGTGATTCGCGTGCTTATTTATTATCCAATGAACAATTCTTAC
AAATAAGTCGCGATCATAATTTATTACAAGTTTTACAAGAACGTAAAGCC
AACCCTGAGGTTTATAAAAAACATGAGAAGAATTTATTTTCATTAACACA
ATTTGTTGGTCGCACAAGTAATATTTTTTTGAGTTATGACTTATTCGTAA
ATAAATTAAACCCAAATGAAATTATTGTTTTAACATCAGATGGATTCCAT
AACTATTTTGAATTAAATACATTATATGAAAAATTAATAAAAAGCACCCA
AGAGACAAAAAATGAACTTTTACAACAATTAATAAGACAAGCTATTATCA
ACGGTAGCAATGATAATTTATCATTAGCTTTCTTAATTTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy