Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR175 IGR173 IGR172 IGR176 IGR168 IGR170 IGR169 IGR177 IGR178 IGR174 IGR171 UU208 rpL21, - UU212 rpL27, - UU210 UU211 UU209 UU207 rpL28, - UU209.1 ptc1, - UU215 UU217 UU214 pkn, - UU216 amt, - UU218 UU208 rpL21, - UU212 rpL27, - UU210 UU211 UU209 UU207 rpL28, - UU209.1 ptc1, - UU215 UU217 UU214 pkn, - UU216 amt, - UU218 Type: tandem, Name:  - 135 Type: tandem, Name:  - 132 Type: tandem, Name:  - 137 Type: tandem, Name:  - 133 Type: tandem, Name:  - 134 Type: tandem, Name:  - 136 Type: tandem, Name:  - 427 UU208 UU211 UU209 UU207 rpL21, - UU212 rpL27, - UU210 rpL28, - UU209.1 ptc1, - UU215 UU217 UU214 pkn, - UU216 amt, - UU218 gmk, - UU213 gmk, - UU213
* Calculated from Protein Sequence

Gene ID: UU214

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
256674

Gene Stop:
257684

Gene Length:
1011

Molecular Weight*:
39287

pI*:
10.40

Net Charge*:
16.15

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
An instance of similarity beginning 30 or so residues in from the
start -- to other proteins also manifesting a "leader" of sorts.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to numerous hypothetical proteins. E.g. residues 31-336 are 25% similar to YLON_BACSU, and 31-332 are 25% similar to YFGB_ECOLI.
Similar to TP0068, a conserved hypothetical protein of T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0820 is eh--c--u.
Cog name: Uncharacterized BCR!!.
Functional class: S.
BeTs to e---c--u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Weakly similar to UU139, UU293, UU455, and UU575, all of which are hypothetical proteins.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
29
non-globular  
30  
88
transmembrane  
94  
117
non-globular  
122  
336

PDB Hit:


Gene Protein Sequence:
MKLNNHNLKEIYSLSLNELKEELFKLGLKSFISKQIYSWIYQKRIFNFDK
FSNIAKNNVIILKENFSNNLLKINSYQSNSDGSIKFEFLTDKNLIINCMI
IKFKNGFLIKINPFGINFKKEIINLSTNELVLQILLIQQFLDQRKLGNIT
NVIIKGLQDSLLNMDVVSNFINIINNENGLNIGKRKIAVWTSGINVDLIK
WGQLQNQIELIISMNASNSLIYQKIMLKKLNQNWSFLKLIEQIKAYTKIT
NNRVVLEYLLIDKINDDLNYANELVELLKNILCYVLLIPYNLNNYRTSAN
LDDFFNILSVNKIRISKRIRKSNDLDISFKQLKIKE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTAAACAATCATAATCTAAAAGAAATTTATTCATTATCATTAAA
TGAACTTAAAGAAGAATTATTTAAATTAGGCTTAAAATCTTTTATTAGCA
AACAAATTTATTCTTGGATTTATCAGAAACGAATTTTTAATTTTGATAAA
TTTTCTAATATTGCTAAAAATAATGTAATAATTCTAAAAGAAAATTTTAG
TAATAATCTATTAAAAATTAACAGTTATCAATCAAATTCTGATGGTTCAA
TTAAGTTTGAATTTTTAACAGATAAAAATCTGATTATTAATTGCATGATT
ATTAAATTTAAAAACGGATTTTTAATAAAAATAAATCCGTTTGGAATTAA
TTTTAAAAAAGAAATTATTAATTTATCAACTAATGAATTAGTATTACAAA
TTTTATTAATACAACAATTTCTAGATCAACGTAAATTAGGCAACATTACT
AATGTTATTATAAAAGGATTACAGGATAGCTTATTAAATATGGACGTTGT
ATCAAACTTCATTAATATTATTAATAATGAAAATGGTTTAAATATTGGAA
AAAGGAAAATTGCAGTTTGAACAAGTGGTATAAATGTTGATTTGATTAAA
TGAGGACAATTACAAAATCAAATAGAATTGATTATTAGTATGAATGCTTC
AAACTCATTAATTTATCAAAAAATAATGTTGAAGAAACTAAATCAAAATT
GATCTTTTTTAAAATTAATTGAGCAAATTAAGGCATATACAAAGATTACA
AATAATCGCGTTGTATTAGAATATTTATTAATTGATAAAATTAATGATGA
TTTAAATTATGCTAATGAATTAGTAGAATTATTAAAAAACATCTTATGTT
ATGTGCTTTTAATTCCTTATAATTTAAATAATTATCGAACTAGTGCTAAT
TTAGATGATTTTTTTAATATTTTATCTGTTAATAAAATACGAATTAGTAA
GCGTATACGAAAAAGTAACGATTTAGATATTAGTTTTAAACAATTGAAAA
TTAAGGAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy