Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR175 IGR167 IGR172 IGR173 IGR176 IGR168 IGR170 IGR169 IGR177 IGR178 IGR174 IGR171 UU208 rpL21, - UU212 rpL27, - UU210 UU211 UU209 plsX, - UU206 UU207 rpL28, - UU209.1 ptc1, - UU215 UU217 UU214 pkn, - UU216 amt, - UU218 UU208 rpL21, - UU212 rpL27, - UU210 UU211 UU209 plsX, - UU206 UU207 rpL28, - UU209.1 ptc1, - UU215 UU217 UU214 pkn, - UU216 amt, - UU218 Type: tandem, Name:  - 135 Type: tandem, Name:  - 132 Type: tandem, Name:  - 137 Type: tandem, Name:  - 133 Type: tandem, Name:  - 134 Type: tandem, Name:  - 136 Type: tandem, Name:  - 427 UU208 UU211 UU209 plsX, - UU206 UU207 rpL21, - UU212 rpL27, - UU210 rpL28, - UU209.1 ptc1, - UU215 UU214 pkn, - UU216 amt, - UU218 gmk, - UU213 gmk, - UU213 UU217
* Calculated from Protein Sequence

Gene ID: UU212

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpL21  

Definition:
50S ribosomal protein L21

Gene Start:
255800

Gene Stop:
255498

Gene Length:
303

Molecular Weight*:
11314

pI*:
10.90

Net Charge*:
11.70

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
See Prosite PDOC00899.


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to 50S ribosomal protein L21 sequences.
E.g. residues 1-98 are 39% similar to RL21_BACSU (50S RIBOSOMAL PROTEIN L21).
UU212 is also similar to MG232, TP0745 and CT420, predicted L21 sequences.






COGS Summary:  COGS Search
The phylogenetic pattern of COG0261 is ehgpc--u.
Cog name: 50S ribosomal protein L21.
Functional class: J.
BeTs to e-g-c--u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 2-25, 56-79, 33-62, 23-52, and 63-97 are members of blocks BL01169A-C (ribosomal protein L21 proteins)


ProDom Summary:  Protein Domain Search
Residues 2-70 are 47% similar to a domain of RL21_BACSU, a predicted ribosomal L21 50S protein.
Other residues are weakly similar to RL21 domains of MYCGE, MYCPN,
and ECOLI.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 1 to 92 (E-value = 1.6e-53) place UU212 in the Ribosomal_L21p family which is described as Ribosomal prokaryotic L21 protein (PF00829)

PDB Hit:


Gene Protein Sequence:
MFAIFQTGGKQYKVQQGEKIYVEKLDLEVGSKISFDQVIMVEGSVGTPFV
KNAVVNATVIKQGKQKKINIIKFKSKKHHLKRQGHRQPYTQLVIDSISVK
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTGCTATTTTTCAAACAGGCGGAAAACAATACAAAGTTCAACAAGG
CGAAAAAATCTATGTTGAAAAACTAGATTTAGAAGTTGGTAGTAAAATTT
CATTTGATCAAGTTATTATGGTAGAAGGTAGTGTTGGTACTCCTTTTGTA
AAAAATGCTGTAGTTAATGCTACTGTTATAAAACAAGGAAAACAAAAGAA
GATCAACATTATTAAATTTAAATCTAAAAAACACCATTTAAAACGTCAAG
GTCATCGACAACCATATACACAATTAGTTATTGATTCAATTAGTGTTAAG
TAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy