Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR175 IGR167 IGR172 IGR173 IGR176 IGR168 IGR170 IGR169 IGR177 IGR174 IGR171 UU208 rpL21, - UU212 rpL27, - UU210 UU211 UU209 plsX, - UU206 UU207 rpL28, - UU209.1 ptc1, - UU215 UU217 UU214 pkn, - UU216 UU208 rpL21, - UU212 rpL27, - UU210 UU211 UU209 plsX, - UU206 UU207 rpL28, - UU209.1 ptc1, - UU215 UU217 UU214 pkn, - UU216 Type: tandem, Name:  - 135 Type: tandem, Name:  - 132 Type: tandem, Name:  - 427 Type: tandem, Name:  - 133 Type: tandem, Name:  - 134 Type: tandem, Name:  - 136 UU208 UU211 UU209 plsX, - UU206 UU207 rnc, - UU205 rnc, - UU205 rpL21, - UU212 rpL27, - UU210 rpL28, - UU209.1 ptc1, - UU215 UU217 UU214 pkn, - UU216 gmk, - UU213 gmk, - UU213
* Calculated from Protein Sequence

Gene ID: UU210

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpL27  

Definition:
50S ribosomal protein L27

Gene Start:
255178

Gene Stop:
254876

Gene Length:
303

Molecular Weight*:
10965

pI*:
10.80

Net Charge*:
11.22

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table

Comment:
See Prosite PDOC00652.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to 50s ribosomal protein L27 sequences, e.g. residues 1-94 are 64% similar to RL27_MYCPN. Residues 9-95 are 66% similar to RL27_BACSU
UU210 is similar to MG234 of M.genitalium, TP0743 of T.pallidum, and CT419 of C.trachomatis, all of which are predicted L27 proteins.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0211 is ehgpc-yu.
Cog name: 50S ribosomal protein L27.
Functional class: J.
BeTs to -h-pc-yu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 14-42 and 34-62 represent block BL00831A (ribosomal protein L27 proteins) and residues 43-82 represent block BL00831B (ribosomal protein L27 proteins.)

ProDom Summary:  Protein Domain Search
Residues 14-94 constitute a defined domain of RL27_MYCPN.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 14 to 94 (E-value = 1.5e-44) place UU210 in the Ribosomal_L27 family which is described as Ribosomal L27 protein (PF01016)

PDB Hit:
None.

Gene Protein Sequence:
MNKLYWLTDLQLFASKKGVGSSKNGRDSNPKYLGAKLGDGQSTKAGQIIY
RQRGNKIYPGLNVGQGKDHTLFAKTAGVVKYTKFMGDKTKVSVLPKEDNN
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAAATTATACTGATTAACTGACTTACAACTTTTTGCTTCTAAAAA
AGGGGTAGGTTCATCTAAAAATGGTCGTGACTCAAATCCTAAATATTTAG
GCGCAAAACTTGGTGATGGGCAATCTACTAAAGCAGGTCAAATTATTTAT
CGTCAAAGGGGCAATAAAATCTACCCTGGATTAAATGTTGGACAAGGTAA
AGACCACACTTTATTTGCAAAAACTGCTGGTGTGGTAAAATACACTAAAT
TTATGGGAGATAAAACAAAAGTTAGTGTTCTTCCAAAAGAAGATAATAAT
TAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy