Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR175 IGR167 IGR172 IGR173 IGR176 IGR168 IGR170 IGR169 IGR166 IGR174 IGR165 IGR171 UU208 rs15,rpS15, - UU204 rpL27, - UU210 rpL21, - UU212 UU211 UU209 plsX, - UU206 UU207 rpL28, - UU209.1 ptc1, - UU215 UU214 pkn, - UU216 UU208 rs15,rpS15, - UU204 rpL27, - UU210 rpL21, - UU212 UU211 UU209 plsX, - UU206 UU207 rpL28, - UU209.1 ptc1, - UU215 UU214 pkn, - UU216 Type: tandem, Name:  - 135 Type: tandem, Name:  - 132 Type: tandem, Name:  - 133 Type: tandem, Name:  - 134 Type: tandem, Name:  - 427 UU208 UU211 UU209 plsX, - UU206 UU207 rnc, - UU205 rnc, - UU205 rs15,rpS15, - UU204 rpL27, - UU210 rpL21, - UU212 rpL28, - UU209.1 ptc1, - UU215 UU214 pkn, - UU216 gmk, - UU213 gmk, - UU213
* Calculated from Protein Sequence

Gene ID: UU209.1

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpL28  

Definition:
50S ribosomal protein L28

Gene Start:
254259

Gene Stop:
254453

Gene Length:
195

Molecular Weight*:
7147

pI*:
12.40

Net Charge*:
12.70

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular assembly; Ribosome assembly

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed significant hits to ribosomal protein L28 proteins, e.g. residues 1-50 are 56% similar to RL28_MYCPN, ribosomal protein L28 of Mycoplasma pneumoniae (AE000022). Also similar to ribosomal proteins L28 in M. genitalium and B. subtilis. Similar to MG426 and TP0362.
No similarity to C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0227 is ehgpc-yu.
Cog name: 50S ribosomal protein L28.
Functional class: J.
BeTs to e-g-c--u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 2-39 represent significant (100%) hits to block PF00830, ribosomal L28 proteins.

ProDom Summary:  Protein Domain Search
Residues 4-59 constitute a defined domain of RL28_MYCGE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 3 to 61 (E-value = 4.3e-25) place UU209.1 in the Ribosomal_L28 family which is described as Ribosomal L28 family (PF00830)

PDB Hit:
None.

Gene Protein Sequence:
MAKRDQLTGKGPLSGNTRSHAMNHSKRRWNVNLQKATIKTENGSQRVLVS
AKTLKTLKKHNLLA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAAAAGAGATCAATTAACAGGCAAAGGTCCTTTAAGTGGGAATAC
ACGTTCACATGCTATGAATCATTCAAAGCGTCGTTGAAATGTTAATTTAC
AAAAAGCAACTATTAAGACTGAAAACGGGAGCCAACGTGTATTAGTTTCA
GCTAAAACACTAAAAACACTTAAAAAGCATAATTTATTAGCCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy