Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR167 IGR173 IGR172 IGR168 IGR170 IGR169 IGR166 IGR174 IGR165 IGR171 UU208 rs15,rpS15, - UU204 rpL27, - UU210 rpL21, - UU212 UU211 UU209 plsX, - UU206 UU207 rpL28, - UU209.1 UU214 copA, - UU203 UU208 rs15,rpS15, - UU204 rpL27, - UU210 rpL21, - UU212 UU211 UU209 plsX, - UU206 UU207 rpL28, - UU209.1 UU214 copA, - UU203 Type: tandem, Name:  - 403 Type: tandem, Name:  - 132 Type: tandem, Name:  - 133 Type: tandem, Name:  - 134 Type: tandem, Name:  - 427 UU208 rs15,rpS15, - UU204 UU211 UU209 plsX, - UU206 UU207 rnc, - UU205 rnc, - UU205 rpL27, - UU210 rpL21, - UU212 rpL28, - UU209.1 UU214 copA, - UU203 gmk, - UU213 gmk, - UU213
* Calculated from Protein Sequence

Gene ID: UU207

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
253137

Gene Stop:
251443

Gene Length:
1695

Molecular Weight*:
64004

pI*:
5.90

Net Charge*:
-6.20

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to hypothetical protein sequences, e.g. residues
1-564 are 35% similar to MG369. Also similar to YloV protein of B. subtilis(Z99112), and a hypothetical protein of S. coelicolor
(AL034447).

COGS Summary:  COGS Search
No related COGS.

Blocks Summary:  Blocks Search
Residues 75-110 and 434-469 are members of block BL01251A (proliferating cell nuclear antigen proteins.)

ProDom Summary:  Protein Domain Search
Residues 79-543 and 3-76 constitute defined domains of Y369_MYCGE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 34 to 199 (E-value = 2.9e-63) place UU207 in the Dak2 family which is described as DAK2 domain (PF02734)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
185  
278

PDB Hit:


Gene Protein Sequence:
MKTIKLDLFQKMLYAGAKILEIECEYINDLNVFPVPDGDTGSNMKTTTAG
AIIAIKEIEISNFSQLAKIFSRGLLMNARGNSGVILSQIFRGFMDALNND
AYEVSIEQLKQAFNGAKEKAYASVSTPIEGTILTVIRVINERISERQNFD
SVEDLFAFVTKEAQIILERTPEMLPSLKEANVVDSGGYGLVSFLKGMYQS
LTNTFDEKLIIKNEEENIKSKTKPLDLEIIHKEKEEGFGYCSEIILSLRK
KIIPNSPSKSFFEFEKYKSELAKIGDSIVAIQDEDLVKVHLHTLTPYKFL
QLSQKYGEFDKIKIENMTNQFYESLERKGLTTKKENKLTLSMEQKIIATV
PSEKFKKMFIEEHGIDNVIVTETEGAPSIQRFVDEINSTNSSQIFIVTDD
SNIVLAAEQASKIVAENNILVSVIGAYNVFETLLAISHFEQQNDYRTNFK
TMNKIVKKARSGMITTSIKNVKYPHITVNKDDYIGIINKKIIASEKNAYD
VLLKTIEMLIESLKKPEICYIYYGINASQTDVHQIEKYISEKYGIICDLR
YTGQSLYHYYIGIQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAACAATTAAGTTAGATCTTTTTCAAAAAATGTTATATGCAGGTGC
AAAAATATTAGAAATTGAATGTGAATATATTAACGATTTAAATGTTTTTC
CTGTTCCAGATGGTGATACTGGTTCAAACATGAAAACCACAACAGCTGGT
GCAATTATTGCTATTAAAGAGATAGAAATATCCAATTTTTCCCAACTTGC
TAAAATTTTTAGTCGTGGTCTATTAATGAACGCCAGAGGTAACTCTGGTG
TTATTTTAAGTCAAATATTTCGTGGATTTATGGATGCTTTAAATAACGAT
GCTTATGAAGTTAGTATTGAACAATTAAAACAAGCTTTTAATGGTGCAAA
AGAAAAAGCTTATGCAAGCGTCTCTACACCTATTGAAGGAACAATTTTAA
CAGTCATTCGCGTTATTAATGAGCGAATAAGTGAACGTCAAAATTTTGAT
AGTGTCGAAGATTTATTTGCATTTGTTACAAAAGAAGCGCAAATCATTCT
AGAAAGAACACCAGAAATGTTACCTTCGCTAAAAGAAGCTAATGTTGTTG
ATTCTGGTGGATATGGTTTAGTAAGTTTTCTAAAAGGAATGTATCAAAGC
TTAACAAATACATTTGATGAAAAATTAATTATTAAAAACGAAGAAGAAAA
TATTAAATCAAAGACTAAACCGCTTGATCTTGAAATTATACATAAAGAAA
AAGAAGAAGGTTTTGGTTATTGTAGTGAAATTATTTTATCTTTACGAAAA
AAAATTATCCCTAATTCACCAAGTAAAAGTTTTTTTGAATTTGAAAAATA
TAAAAGTGAATTAGCAAAAATCGGTGATAGTATTGTAGCAATCCAAGATG
AAGATCTAGTTAAAGTTCATTTGCATACCCTAACTCCTTATAAATTCTTA
CAATTATCACAAAAATATGGTGAATTTGATAAGATTAAAATTGAAAACAT
GACAAACCAATTTTATGAAAGTTTAGAACGAAAAGGGTTGACTACAAAAA
AAGAAAATAAATTGACTTTAAGTATGGAGCAAAAAATTATTGCAACAGTT
CCATCTGAAAAGTTTAAAAAAATGTTTATTGAAGAACATGGTATTGATAA
TGTTATTGTTACTGAAACAGAAGGAGCTCCATCAATTCAACGTTTTGTCG
ATGAAATTAACTCAACAAACTCTTCACAAATTTTTATTGTCACTGATGAT
TCAAATATTGTATTAGCTGCTGAACAAGCTTCAAAAATCGTTGCTGAAAA
CAACATTTTGGTTTCTGTAATTGGAGCTTATAATGTTTTTGAAACGCTTT
TAGCGATTTCTCATTTTGAACAGCAAAATGATTATCGCACAAATTTTAAA
ACAATGAATAAAATAGTTAAAAAAGCACGTAGTGGGATGATTACTACTTC
AATTAAAAATGTTAAATATCCACATATTACTGTTAATAAAGATGATTATA
TAGGCATTATTAATAAAAAAATTATCGCTTCTGAAAAAAATGCTTATGAT
GTTTTATTAAAAACAATTGAAATGTTAATTGAAAGTTTAAAAAAACCAGA
AATTTGTTATATATATTATGGCATTAATGCTTCACAAACAGATGTACATC
AAATTGAAAAATACATTTCAGAAAAATATGGAATTATTTGTGATTTAAGA
TATACTGGTCAAAGTTTATATCATTACTACATAGGAATTCAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy