Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR164 IGR167 IGR168 IGR162 IGR170 IGR169 IGR166 IGR163 IGR165 IGR171 UU208 rs15,rpS15, - UU204 rpL27, - UU210 UU209 plsX, - UU206 UU207 rpL28, - UU209.1 UU202 UU201 pstB, - UU200 copA, - UU203 UU208 rs15,rpS15, - UU204 rpL27, - UU210 UU209 plsX, - UU206 UU207 rpL28, - UU209.1 UU202 UU201 pstB, - UU200 copA, - UU203 Type: tandem, Name:  - 132 Type: tandem, Name:  - 131 Type: tandem, Name:  - 403 Type: tandem, Name:  - 129 Type: tandem, Name:  - 427 Type: tandem, Name:  - 134 Type: tandem, Name:  - 130 Type: tandem, Name:  - 133 UU208 rs15,rpS15, - UU204 rpL27, - UU210 UU209 plsX, - UU206 UU207 rnc, - UU205 rnc, - UU205 rpL28, - UU209.1 UU202 UU201 pstB, - UU200 copA, - UU203
* Calculated from Protein Sequence

Gene ID: UU205

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rnc  

Definition:
ribonuclease III protein

Gene Start:
250453

Gene Stop:
249743

Gene Length:
711

Molecular Weight*:
27555

pI*:
9.60

Net Charge*:
4.69

EC:
3.1.26.3  

Functional Class:
transcription; RNA degradation  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to ribonuclease III, e.g. residues 9-234 are 36% similar to an
RNASE III from RNC_SPICI. Residues 4-234 are 31% similar to an RNASE III in B. subtilis (299112).
UU205 is similar to MG367, TP0809, and CT297; all of which are predicted RNASE III proteins.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0571 is ehgpC-yu.
Cog name: dsRNA-specific ribonuclease.
Functional class: K.
BeTs to e--pc-yu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 25-31, 42-53, 125-138 are similar to blocks BL00517A-C, which encompass ribonuclease III family proteins.
E.g. RNC_HELPY, RNC_BACSU

ProDom Summary:  Protein Domain Search
Residues 8-93 are 46% similar to a ribonuclease domain as observed in Q49034_MYCCA.
Residues 97-192 are 31% similar to a ribonuclease domain as observed in O31734_BACSU.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 43 to 140 (E-value = 1.6e-24) place UU205 in the Ribonuclease_3 family which is described as RNase3 domain (PF00636)
Residues 167 to 229 (E-value = 2.5e-05) place UU205 in the dsrm family which is described as Double-stranded RNA binding motif (PF00035)

PDB Hit:


Gene Protein Sequence:
MDNKKFLDFLKQNRIEPKNLSIYLEALTHKSYANEHKLTKNYQRLEFLGD
ACVEWVISNFIFNYKIKDNEKMRSLDEGEMTRARSNMVRSEILSYAAKDL
GLTDFLMIGVGLEQDQSARMEKIYEDIFEAFIGAVAQDQGIKKVSLILEK
TLIKYFREGQINYQKDYKTIFQEQAQRINKKPIMYKLVRNEGDKKEVHLV
WNDLIYGIGIASTRKEAEILAAKNAILKLDDYTKKA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGACAATAAAAAATTTTTAGATTTTTTAAAACAAAATAGAATTGAACC
AAAAAATTTATCTATTTATCTTGAAGCATTAACACATAAATCTTATGCAA
ACGAGCATAAACTTACTAAAAACTATCAACGTTTAGAATTTTTAGGTGAT
GCTTGTGTTGAATGGGTAATTAGCAATTTTATTTTTAACTACAAAATTAA
AGATAATGAAAAAATGCGTTCTTTAGATGAAGGTGAAATGACTCGAGCGC
GTTCTAATATGGTACGAAGCGAGATTTTATCATATGCTGCTAAAGATTTA
GGGTTAACTGATTTTTTAATGATTGGTGTTGGTTTAGAACAAGACCAATC
AGCTCGTATGGAAAAAATCTATGAAGATATTTTTGAAGCATTTATAGGTG
CTGTAGCTCAAGATCAAGGTATTAAAAAAGTTTCATTAATTCTTGAAAAA
ACTTTAATTAAATATTTTAGAGAAGGCCAAATTAATTATCAAAAAGATTA
TAAAACGATTTTTCAAGAACAAGCCCAACGTATTAATAAAAAACCTATTA
TGTATAAATTAGTACGTAATGAAGGCGATAAAAAAGAAGTCCATTTAGTT
TGAAATGATTTAATTTATGGAATTGGAATAGCATCAACGCGAAAAGAAGC
AGAAATTTTAGCAGCTAAAAATGCAATTTTAAAACTTGATGATTATACAA
AAAAAGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy