Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR148 IGR150 IGR149 eno, - UU184 pyk,pk,kpyK, - UU186 rpoC, - UU188 rpoB, - UU187 eno, - UU184 pyk,pk,kpyK, - UU186 rpoC, - UU188 rpoB, - UU187 Type: tandem, Name:  - 123 Type: tandem, Name:  - 120 Type: tandem, Name:  - 121 Type: tandem, Name:  - 122 eno, - UU184 pyk,pk,kpyK, - UU186 rpoC, - UU188 rpoB, - UU187 pfkA,pfk-1,k6pF, - UU185 pfkA,pfk-1,k6pF, - UU185
* Calculated from Protein Sequence

Gene ID: UU187

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpoB  

Definition:
DNA-directed RNA polymerase beta chain

Gene Start:
225605

Gene Stop:
229909

Gene Length:
4305

Molecular Weight*:
162027

pI*:
5.20

Net Charge*:
-36.65

EC:
2.7.7.6  

Functional Class:
transcription; DNA-dependent RNA polymerase  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Comment:
DNA-dependent RNA polymerase catalyzes the transcription of DNA
into RNA using the four ribnucleoside triphosphates as substrates.

Activity: N nucleoside triphosphate = N pyrophosphate + RNA(N).

Bacterial RNA polymerase consists of a sigma factor and a core enzyme composed of two alpha, one beta and one beta' chains. The alpha, beta, and beta' chains in U.u. are UU257, UU187, and UU188 respectively. The sigma factor is UU349. There is also a probable delta sequence: UU597.

Reference: Eur J Biochem. 1981 Jun 1;116(3):621-9.

Blast Summary:  PSI-Blast Search
A gapped BLAST reveals a number of significant hits to proteins described as DNA-directed RNA Polymerase Beta Chain. For example: UU187 residues 1-1413 are 52% similar to residues 1-1387 of RPOB_MYCGA (M.gallisepticum). Other significant hits are against (but not limited to) the RpoB proteins of M.pneumoniae (RPOB_MYCPN), B.subtilis (RPOB_BACSU), S.aureus (RPOB_STAAU) and B.burgdorferi (RPOB_BORBU).

A BLAST against the STDPRO database reveals significant hits to proteins described as DNA-directed RNA polymerase beta subunit (rpoB) in M.genitalium (MG341), T.pallidum (TP0241) and C.trachomatis (CT315). For example: UU187 residues 1-1405 are 50% similar to residues 1-1382 of MG341.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0085 is ehgpcMYu.
Cog name: DNA-dependent RNA polymerase beta subunit.
Functional class: K.
BeTs to -hg-cmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 124-141, 533-542, 670-694, 784-813, 912-935, 995-1005, 1080-1121 and 1261-1310 rank in the 100.00th percentile to Block BL01166(A through H respectively), described as RNA polymerases beta chain proteins.

ProDom Summary:  Protein Domain Search
Residues 709-961 are 57% similar, residues 963-1147 are 67% similar, and residues 507-704 are 63% similar to a defined domain of RPOB_MYCGA.


Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 32 to 631 (E-value = 3.5e-25) place UU187 in the RNA_pol_Rpb2_1 family which is described as RNA polymerase beta subunit (PF04563)
Residues 632 to 704 (E-value = 1.4e-34) place UU187 in the RNA_pol_Rpb2_3 family which is described as RNA polymerase Rpb2, domain 3 (PF04565)
Residues 837 to 1300 (E-value = 1.9e-232) place UU187 in the RNA_pol_Rpb2_6 family which is described as RNA polymerase Rpb2, domain 6 (PF00562)
Residues 1302 to 1378 (E-value = 5.1e-46) place UU187 in the RNA_pol_Rpb2_7 family which is described as RNA polymerase Rpb2, domain 7 (PF04560)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
222  
273
coil-coil  
282  
331
non-globular  
368  
483
non-globular  
519  
653
non-globular  
1125  
1245
coil-coil  
1385  
1421

PDB Hit:


Gene Protein Sequence:
MQNNKNYTEKFITDKVMRRDYSKIKSNFEGPNLLEIQVESFKRFMEKDLK
EVISSIFPLKSPQGKYTLAFKGLKIKQPTKDESACRDEGKTFETPIYIDL
ELTDNYTGEVKRAQRNTKTGEDGIYLGAIPKMTEKGTFVINGIEKFVISQ
IVRSPGIYVLGKSSIKLNGSRKRLFEGKICEIYPSKGTLMLGYIPKDRHN
IQIVARDSSGDNAQTFSVTTLLKAFGLTSAEILKIFNNEKEIRESLEIEK
YAPEYIFENSQENEIIFKIYSDAHDIHEKADRRESNNKLKEEYIEQGSPL
LSKLKQLIFNYVEKNDEIDALLHENKDVEDASFIKNNKKLYDEREEIINC
IISEKAAKDIVELLGINIKNIETLRHLGKASYQIALQQHFFNKRLYDISS
AGRYKFEKKLLLSERLYQKVIANDIIDKKNNILIPKDTLITKEHIELIKK
ESRDKNIKWTKKINLLPTALESEIEQFLEYESIAVYKDNDLRDETTEIVG
LASGCKLQTLTVADLVATTSYIYNLNYEIGEFDDIDHLGNKRLKLIHELL
RARIATSMARIEKFINEKLAISDGSSNNITNVNDKGIDTELDREIEESDM
SDEEKKKAISVKSIINTKQFQSLVKDFFNSHQLIQFIDQQNPLAELTNKR
RISAMGPGGISREDPNLDIRDVHHSHSSRICPIETPEGMNIGLIMSLASL
AKVDENGFIVAPYYVVEDGVVKEDYKYLTAHEDDNYIIAESSVQLDENKR
ILDEQVVARYRGSTGLFSPNEVDFIDIVPKQVVSIAASAIPFIENDDGAR
ALMGSNMQRQATPLIKPYAPIVGTGTEFKIAHDSGMAVVAKNDGVVEFVD
SQKIIIRNDNDKLDDYKLIKYRKSNQDTCNNQIPIVKVGQRVHKSETIGD
GPAMQNGELALGRNILVGYTTWRGYNFEDAIIISERLVDQDVFTSIHIDE
HTIQCMKTKNGDEEITRDMPNVSDTAKRFLDNQGIVLVGAEVHEGDVLVG
KTTPRGNVETAPEDRLLQTIFGDKSKTVKDSSLKVKHGQEGIVAAVKRIK
SSDENGSELPDDVIEIIKVYIVQKRKIQVGDKMAGRHGNKGIVSKVVPIQ
DMPFLKDGTPLDIMLNPLGVPSRMNIGQILELHLGYAAAEIGKKQLIQIA
IDQLGYEKYISLFGINEIIAKKLYENISNLIKHKQAKQAKDIDLIDVTII
LKELGLSYDDIGIKISTPVFDGANHDDIVSIMNEANIDIENNKGKQVLYD
GRTGEPFDGLISVGLTYMLKLDHMVDDKIHSRSVGPYSKITQQPLGGKSQ
NGGQRFGEMEVWALEAYGAAYNLLEILTIKSDDVQGRNQAYNAIIKGHDV
VADGMPESFKLLTKQMQGLGLCITVETKDDRMVDINEYTLNQNRLNNDDD
EVILDENLKEINDSNEEIFNTNFNNNDYDDEENF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAAATAATAAAAATTATACTGAGAAATTTATTACTGATAAAGTAAT
GCGAAGAGATTATTCAAAAATTAAATCTAATTTTGAAGGACCAAATCTAC
TTGAAATTCAAGTTGAATCTTTTAAACGCTTTATGGAGAAAGATTTAAAA
GAAGTTATTTCAAGTATTTTTCCATTAAAATCTCCTCAGGGTAAGTATAC
GTTAGCATTTAAAGGTTTAAAAATTAAGCAGCCAACAAAAGATGAAAGTG
CTTGTCGTGACGAAGGTAAAACATTTGAAACACCAATTTATATTGATTTG
GAATTAACAGATAACTACACAGGTGAAGTTAAACGTGCACAACGAAATAC
TAAAACAGGAGAAGATGGTATTTATTTAGGAGCAATTCCCAAAATGACAG
AAAAAGGAACTTTTGTTATTAATGGAATTGAAAAATTTGTTATCTCACAA
ATTGTTAGATCACCAGGAATTTATGTACTTGGTAAATCAAGCATCAAATT
GAACGGTTCACGTAAGCGTTTATTTGAAGGCAAAATTTGTGAAATTTATC
CTTCTAAGGGTACTTTGATGCTTGGTTATATTCCTAAGGATCGTCATAAT
ATTCAAATTGTTGCACGTGATTCATCTGGTGATAATGCGCAAACATTTTC
AGTAACTACTTTACTAAAAGCTTTTGGTTTAACAAGTGCTGAAATCTTAA
AAATTTTTAATAATGAAAAAGAGATTCGTGAATCATTAGAAATTGAAAAA
TATGCGCCAGAATATATTTTTGAAAATTCACAAGAAAATGAAATTATTTT
TAAAATTTATAGTGATGCTCATGATATTCATGAGAAAGCCGATCGTCGAG
AATCAAATAATAAGTTAAAAGAAGAATATATAGAACAAGGTTCACCACTT
TTATCAAAGTTAAAACAACTAATTTTTAATTATGTTGAAAAAAACGATGA
AATTGATGCATTATTACATGAAAATAAAGATGTTGAAGATGCTAGTTTCA
TTAAGAATAATAAAAAATTATATGATGAAAGAGAAGAAATCATTAATTGC
ATCATTAGTGAAAAAGCAGCTAAGGATATCGTTGAATTATTAGGTATTAA
TATTAAAAATATAGAAACACTAAGACATTTAGGCAAAGCTTCTTATCAAA
TAGCTTTACAACAACATTTTTTTAATAAGCGTTTATATGATATTAGTAGT
GCTGGACGCTATAAATTTGAAAAAAAATTATTATTAAGTGAACGTTTATA
TCAAAAAGTAATTGCGAATGATATTATTGATAAAAAAAATAATATTCTAA
TTCCTAAAGATACTTTAATTACTAAAGAACATATCGAACTAATAAAAAAA
GAATCACGTGATAAAAACATTAAATGAACAAAAAAAATTAATTTATTACC
AACAGCATTAGAATCAGAAATTGAACAATTTTTAGAATATGAAAGTATTG
CAGTTTATAAAGATAATGATTTAAGAGATGAAACAACAGAGATTGTCGGT
CTAGCATCAGGTTGCAAACTTCAAACTTTAACCGTGGCTGACTTAGTTGC
TACAACAAGTTATATTTATAACTTGAATTATGAAATTGGTGAATTTGATG
ATATAGATCATTTAGGTAATAAAAGACTTAAATTGATTCATGAATTATTA
CGAGCAAGAATTGCTACAAGTATGGCTCGTATTGAGAAGTTTATTAATGA
AAAGTTGGCTATTTCTGATGGTTCAAGCAATAACATTACAAATGTTAATG
ATAAAGGTATTGATACTGAACTTGATCGTGAAATTGAAGAAAGCGATATG
AGTGATGAGGAAAAGAAAAAAGCAATTAGTGTTAAATCAATTATTAATAC
AAAACAATTCCAAAGTTTAGTTAAAGATTTTTTTAATTCACATCAATTAA
TTCAATTTATTGACCAACAAAATCCATTAGCAGAATTAACTAATAAACGT
CGTATTTCAGCGATGGGTCCAGGAGGAATTAGTCGTGAAGACCCTAATTT
AGATATTCGTGATGTTCATCACTCTCACTCTTCGCGTATTTGCCCGATTG
AAACACCAGAAGGAATGAATATTGGGTTGATTATGTCTTTAGCATCACTT
GCAAAAGTAGATGAAAATGGTTTTATTGTAGCACCTTATTATGTTGTTGA
GGATGGGGTTGTAAAAGAAGATTATAAATATTTAACAGCCCATGAAGATG
ATAACTATATTATTGCTGAATCATCAGTCCAATTAGATGAAAATAAACGA
ATTTTAGATGAACAAGTTGTTGCTCGATATCGTGGCTCAACAGGTTTATT
TAGTCCTAATGAAGTTGATTTTATTGATATTGTTCCAAAACAAGTAGTAT
CAATTGCTGCATCAGCAATTCCATTTATTGAAAATGACGATGGGGCACGT
GCTTTGATGGGGTCAAACATGCAACGTCAAGCAACACCTTTAATTAAACC
ATATGCCCCTATTGTAGGGACAGGTACAGAATTTAAAATTGCACACGATT
CAGGAATGGCTGTTGTTGCTAAAAATGACGGAGTGGTTGAATTTGTTGAT
AGTCAAAAAATTATCATTAGAAATGATAATGATAAATTAGATGATTATAA
ATTAATTAAATATCGTAAATCAAATCAAGACACATGTAATAACCAAATTC
CAATTGTAAAAGTAGGTCAAAGAGTTCACAAATCTGAAACAATTGGTGAT
GGACCTGCAATGCAAAATGGTGAATTAGCTTTAGGTCGTAATATTCTAGT
TGGTTATACAACTTGACGAGGTTATAATTTTGAAGATGCTATTATTATTT
CTGAACGTTTAGTTGATCAAGATGTATTTACATCAATTCATATTGATGAG
CATACAATTCAATGTATGAAAACAAAAAACGGTGATGAAGAAATCACTCG
TGACATGCCTAATGTCTCTGATACTGCAAAACGTTTTTTAGATAATCAAG
GTATCGTTTTAGTTGGCGCTGAAGTTCATGAAGGAGATGTTTTAGTTGGA
AAAACAACTCCACGAGGTAATGTTGAAACTGCTCCAGAAGATCGTTTATT
GCAAACAATTTTTGGCGATAAATCAAAAACAGTTAAAGATTCATCACTAA
AAGTAAAACACGGTCAAGAAGGAATTGTTGCTGCTGTTAAGCGAATTAAA
TCAAGTGATGAAAATGGTAGTGAATTACCAGATGACGTAATTGAAATTAT
CAAAGTTTATATTGTTCAAAAACGTAAAATTCAAGTTGGTGACAAAATGG
CAGGGCGTCATGGAAATAAAGGAATTGTATCAAAAGTTGTTCCTATTCAA
GATATGCCTTTTTTAAAAGACGGGACTCCATTAGATATTATGTTAAATCC
ATTAGGTGTACCTAGTCGTATGAATATTGGTCAAATTTTAGAATTGCACT
TAGGTTATGCTGCGGCTGAAATAGGTAAAAAACAATTAATTCAAATTGCA
ATTGATCAATTAGGTTATGAAAAATATATTTCATTGTTTGGAATCAATGA
AATTATTGCTAAAAAACTTTATGAAAATATTAGTAATTTAATTAAACACA
AACAAGCAAAACAGGCAAAAGATATAGATTTAATTGATGTGACAATTATT
CTAAAAGAATTGGGATTATCATATGATGATATTGGAATTAAAATTTCAAC
TCCTGTATTTGATGGTGCAAATCATGATGATATTGTTTCTATTATGAATG
AAGCAAACATTGATATTGAAAATAATAAGGGTAAACAAGTTCTATATGAT
GGAAGAACTGGTGAACCATTCGATGGTTTAATTTCAGTTGGATTAACATA
CATGTTAAAACTAGATCATATGGTTGATGATAAAATTCACAGTCGTTCGG
TTGGTCCATATAGTAAAATTACACAACAACCATTGGGTGGTAAATCACAA
AATGGAGGCCAACGTTTTGGTGAAATGGAAGTTTGAGCTTTAGAAGCTTA
TGGTGCAGCTTATAATTTATTAGAAATTTTAACAATTAAATCCGATGATG
TTCAAGGACGTAATCAAGCTTACAATGCTATTATAAAAGGTCACGATGTT
GTTGCTGATGGAATGCCAGAATCATTTAAATTATTAACAAAACAAATGCA
AGGTTTAGGGTTATGTATTACCGTTGAAACAAAAGATGATCGTATGGTAG
ATATTAATGAATATACACTAAATCAAAATCGTTTAAATAATGACGATGAT
GAGGTTATTTTAGATGAAAATCTAAAAGAGATCAATGATTCTAATGAAGA
AATATTTAATACAAACTTTAATAATAATGACTATGATGATGAAGAGAACT
TCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy