Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR148 IGR146 IGR147 IGR149 UU183 eno, - UU184 pyk,pk,kpyK, - UU186 pgm,pgmI, - UU182 rpoB, - UU187 UU183 eno, - UU184 pyk,pk,kpyK, - UU186 pgm,pgmI, - UU182 rpoB, - UU187 Type: tandem, Name:  - 121 Type: tandem, Name:  - 118 Type: tandem, Name:  - 123 Type: tandem, Name:  - 119 Type: tandem, Name:  - 120 Type: tandem, Name:  - 122 UU183 eno, - UU184 pyk,pk,kpyK, - UU186 pgm,pgmI, - UU182 rpoB, - UU187 pfkA,pfk-1,k6pF, - UU185 pfkA,pfk-1,k6pF, - UU185
* Calculated from Protein Sequence

Gene ID: UU186

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pyk  pk  kpyK  

Definition:
pyruvate kinase (possible frameshift)

Gene Start:
224058

Gene Stop:
225482

Gene Length:
1425

Molecular Weight*:
54542

pI*:
9.40

Net Charge*:
10.20

EC:
2.7.1.40  

Functional Class:
energy metabolism; glycolysis and gluconeogenesis  

Pathway: pathway table
Carbon fixation
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism

Comment:
Taken from Prosite PDOC00101: Pyruvate kinase (EC 2.7.1.40) (PK) catalyzes the final step in glycolysis, the conversion of phosphoenolpyruvate to pyruvate with the concomitant phosphorylation of ADP to ATP. PK requires both magnesium and potassium ions for its activity. PK is found in all living organisms.

Reference:Biochim Biophys Acta. 1969 Apr 22;178(2):420-3.

NOTE: After analysis of the data from BLOCKS, the alignments given from a gapped BLAST and the Pfam 'partial alignment match' it appears that there is the potential for a frameshift in the carboxy terminus of UU186 (starting at ~ amino acid residue 350). In BLOCKS, the last domain that defines pyruvate kinase enzymes is missing, and after studying five other PK enzymes (including the one from B.burgdorferi that shares homology throughout the length of the protein) the domain appears to be essential for function.

See /home/mutant2/tducey/HTML/UU186/BLOCK for a copy of the relevant BLOCK analysis.

In addition to analysis of the BLOCKS and gapped BLAST data, a measure of the G+C content of UU186 at the second base position was done, and the G+C content drops after amino acid residue 360 (nucleotide 1080).

Blast Summary:  PSI-Blast Search
A gapped BLAST reveals significant hits to proteins described as pyruvate kinase (PK). All but one of the proteins shared this similarity in the first approximately 350 amino acid residues (the only exception being B.burgdorferi where UU186 residues 40-454 are 48% similar to residues 21-436 of KPYK_BORBU). Other significant alignments were made to KPYK_MYCPN, where residues 7-358 are 48% similar to UU186 residues 4-353, KPYK_BACPY, where residues 3-328 are 38% similar to UU186 residues 4-352. Other significant hits are seen against (but not limited to), KPYK_BACSU, KPYK_BACST, KPYK_LACDE, KPYK_ECOLI and KPYK_MYCTU.

A BLAST against the STDPRO database reveals two significant hits. One to MG216, described as pyruvate kinase (pyk) and the second to CT332, also described as pyruvate kinase (pyk/pk). UU186 residues 4-449 are 41% similar to residues 7-445 of MG216. However, in both cases, the density of amino acid similarity drops off after amino acid residues 360.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0469 is EhgpCmY-.
Cog name: Pyruvate kinase.
Functional class: C.
BeTs to e-g-cmy-.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 27-72, 82-96, 131-157, 181-232, 244-294, 297-345 and 228-270 rank in the 100.00th percentile to Block BL00110(A through G respectively), described as Pyruvate kinase proteins. However the statistical significance of block G is weak (rank 240) and does not align properly with the rest of the expected protein, possibly indicative of a frameshift or sequencing error at the carboxy terminus of this protein.


ProDom Summary:  Protein Domain Search
Residues 146-360 are 52% similar, and residues 4-145 are 41% similar to a defined domain of KPYK_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogously related proteins in U.u.

Pfam Summary:  Pfam Search
Residues 2 to 370 (E-value = 2.2e-76) place UU186 in the PK family which is described as Pyruvate kinase, barrel domain (PF00224)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
137  
221
coil-coil  
222  
264
non-globular  
343  
474

PDB Hit:
gi|1310978|pdb|1PKY|A Chain A, Pyruvate Kinase From E. Coli In The T-State

Gene Protein Sequence:
MFSKTRIIATVGPATTKLFSNWLEFNDLNNINDAQQVCINIKDLILSGVN
IFRMNLSHGDQKIHLFRTQLIKKIADELKIKVEILFDTKGPEIRVCEMSD
NNFIIKNSEVIIHCKEKVLGSFNEFSVTDATGQYNMISDVKINHRILIDD
GKLILIVKKIDFLKNIIYTTAKNSYSLKTNKRLNLPDANYSLPFLSKKDI
DDINLAVKLKIPYLALSFISNIKQINEVKQLLKKSSFIPKLIAKIETQEA
IDNLEEIIKNTDGIMVARGDLGLEVPFYKIPIYQNKIVELCHKYNKYCII
ATQMLDSLERNIIPTRAEVTDVYYAVKQKVNATMLSGETAAGIDPINAVQ
VMKSIILETENNNIENEITFKKNELLIPKEVKLKILSFHKLKINKHKLLV
VNLISKNSKHLVYDILKYDFNFNILFVIDKNQEHDLLLKNANFIISENKM
LKQEELLKSFNIDFNNHEFLFISI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTTCAAAAACACGCATTATTGCTACAGTAGGTCCAGCAACAACAAA
ATTGTTTTCTAATTGGTTAGAATTTAACGATTTAAATAATATAAATGATG
CTCAACAAGTATGCATAAACATTAAAGATTTAATTTTAAGTGGTGTTAAT
ATTTTTCGTATGAATTTAAGTCATGGCGACCAAAAAATACACCTTTTTCG
TACACAATTAATTAAAAAAATTGCGGATGAATTAAAGATCAAAGTTGAAA
TATTATTTGATACAAAAGGACCAGAAATTCGTGTTTGTGAAATGAGTGAT
AATAATTTTATTATTAAAAATAGTGAAGTTATAATACATTGTAAAGAAAA
AGTTTTAGGTAGTTTTAATGAGTTTAGTGTTACTGATGCTACTGGACAAT
ACAATATGATTAGTGATGTTAAAATTAATCACCGAATTTTAATCGACGAT
GGAAAATTAATTTTAATTGTTAAAAAAATTGATTTTCTAAAAAACATCAT
TTATACAACCGCTAAAAATAGTTATTCATTAAAAACAAATAAACGCTTAA
ATTTACCAGATGCCAATTATAGTTTGCCGTTTTTGTCAAAGAAAGATATT
GATGATATAAATTTAGCAGTTAAATTAAAAATTCCTTATTTGGCTTTATC
GTTTATTTCTAATATTAAACAAATTAATGAGGTTAAACAACTTTTAAAAA
AGTCCTCATTTATACCAAAATTAATTGCAAAAATTGAAACTCAAGAAGCA
ATTGATAATCTAGAAGAAATTATTAAAAATACTGATGGTATCATGGTTGC
GCGTGGGGATTTAGGGCTAGAAGTACCTTTTTATAAAATTCCTATTTATC
AAAATAAAATTGTTGAATTATGCCATAAATACAATAAATATTGTATTATA
GCGACACAAATGTTAGATTCATTAGAACGTAATATTATCCCCACACGAGC
TGAAGTCACAGATGTTTATTATGCCGTTAAACAAAAGGTTAACGCAACAA
TGTTATCAGGCGAAACGGCCGCAGGAATTGATCCAATTAATGCTGTACAA
GTTATGAAATCTATTATTTTAGAGACAGAAAATAATAATATAGAAAACGA
AATAACATTTAAAAAAAATGAATTATTAATTCCTAAGGAAGTTAAATTAA
AAATTTTATCATTTCATAAATTAAAAATAAATAAACATAAATTATTAGTT
GTTAATTTAATTAGTAAAAATTCTAAACATTTAGTTTATGATATATTAAA
ATATGATTTTAATTTTAATATTTTATTTGTTATAGATAAAAATCAAGAAC
ATGATTTATTATTAAAAAATGCTAATTTTATTATTAGTGAAAATAAAATG
TTAAAACAAGAAGAATTATTAAAATCATTTAATATTGATTTTAATAATCA
TGAATTTTTATTTATTTCAATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy