Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR148 IGR145 IGR146 IGR147 IGR149 tpiS,tpiA, - UU181 UU183 eno, - UU184 pyk,pk,kpyK, - UU186 pgm,pgmI, - UU182 rpoB, - UU187 tpiS,tpiA, - UU181 UU183 eno, - UU184 pyk,pk,kpyK, - UU186 pgm,pgmI, - UU182 rpoB, - UU187 Type: tandem, Name:  - 120 Type: tandem, Name:  - 117 Type: tandem, Name:  - 122 Type: tandem, Name:  - 118 Type: tandem, Name:  - 119 Type: tandem, Name:  - 121 Type: tandem, Name:  - 123 tpiS,tpiA, - UU181 UU183 eno, - UU184 pyk,pk,kpyK, - UU186 pgm,pgmI, - UU182 rpoB, - UU187 pfkA,pfk-1,k6pF, - UU185 pfkA,pfk-1,k6pF, - UU185
* Calculated from Protein Sequence

Gene ID: UU185

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pfkA  pfk-1  k6pF  

Definition:
6-phosphofructokinase

Gene Start:
223081

Gene Stop:
224046

Gene Length:
966

Molecular Weight*:
36529

pI*:
7.80

Net Charge*:
2.02

EC:
2.7.1.11  

Functional Class:
energy metabolism; glycolysis and gluconeogenesis  

Pathway: pathway table
Fructose and mannose metabolism
Galactose metabolism
Glycolysis / Gluconeogenesis
Pentose phosphate cycle

Comment:
This enzyme plays a key control step in glycolysis. It catalyzes the following non-reversible reaction:

ATP + D-Fructose-6-Phosphate -> ADP + D-Fructose-1,6,-Bisphosphate.

By similarity to other pfkA enzymes, this enzyme is subject to allosteric activation by ADP, is inhibited by phosphoenolpyruvate and functions as a homotetramer.

See Prosite PDOC00336 for more information.
Reference: Gene. 1987;54(1):65-71.

Blast Summary:  PSI-Blast Search
A gapped BLAST reveals significant hits to proteins described as 6-Phosphofructokinase. For example, residues 11-292 are 31% similar to K6PF_HAEIN and residues 11-292 are 28% similar to K6P1_ECOLI. Other significant hits are found against (but not limited to), K6PF_MYCPN, K6PF_MYCGE, K6PF_SPICI, K6PF_LACDE and K6PF_BACSU.

A BLAST against the STDPRO database reveals significant hits to proteins found in the M.genitalium (MG215), T.pallidum (TP0108) and C.trachomatis (CT207 and CT205) genomes. Residues 9-293 are 29% similar to MG215, described as 6-phosphofructokinase (pfk). Residues 15-187 are 26% similar to TP0108, described as pyrophosphate--fructose 6-phosphate 1-phosphotransferase, alpha subunit (pfpA). Residues 15-185 are 26% similar to CT207, described as pyrophosphate-fructose 6-phosphate 1-phosphotransferase (possible alpha or beta subunit), and residues 15-251 are 21% similar to CT205, described as pyrophosphate-fructose 6-phosphate 1-phosphotransferase (possible alpha or beta subunit).


COGS Summary:  COGS Search
The phylogenetic pattern of COG0205 is ehgpC-Y-.
Cog name: 6-phosphofructokinase.
Functional class: G.
BeTs to -h-pc-y-.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 11-44, 90-121, 128-166 and 257-288 rank in the 99.97th percentile to Block BL00433(A,B,C and D respectively), described as Phosphofructokinase proteins.

Residues 116-135 rank in the 96.44th percentile to Block PR00058D, described as Ribosomal Protein L5 Signature. However, blocks A, B, C, E and F do not show any significant alignment or similarity with UU185.

ProDom Summary:  Protein Domain Search
Residues 11-292 are 32% similar to a defined domain of K6PF_HAEIN.


Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 11 to 293 (E-value = 4.9e-16) place UU185 in the PFK family which is described as Phosphofructokinase (PF00365)

PDB Hit:
gi|230661|pdb|2PFK|D Chain D, Phosphofructokinase (E.C.2.7.1.11)

Gene Protein Sequence:
MNQVNFLNLDKNILIITSGGDAPGMNASLISLIHRLMNNNFNVFIGIEGL
LGLYNNLIEPIKDKRVFDVYFNEQGTVIKTSRFIKLDINDKKTQIIKDNL
LSHNIQKIIILGGQGSMQAGLVLTKMGFEVFGILHTIDNDFSETQMCIGA
LSAASFNQKLLKCLNYTAKAHCAFNLVELMGRECSWLVNNSVGKLKPILM
LTNQDNKYTVDEVIDLIKDKINSIKEYDPLIIVQELIYDQKWYELLVKTF
EQKLHKSLRITILNYLQRGAPVSDFDLQLAKDSANVLVDFIVNQNDIKNT
NNMYVVINKFDNKLEVIKFNK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACCAAGTAAATTTTTTAAATTTAGATAAAAATATTTTAATTATTAC
TTCAGGTGGTGATGCACCGGGTATGAATGCTTCATTAATTTCATTAATCC
ATAGATTAATGAATAATAATTTTAATGTTTTTATAGGAATTGAAGGATTA
TTAGGACTGTACAATAATTTAATTGAACCAATTAAAGATAAACGTGTTTT
TGATGTTTATTTTAACGAGCAAGGAACAGTCATTAAGACAAGTAGATTTA
TTAAATTAGATATTAATGATAAAAAAACACAAATTATTAAAGATAATTTA
TTAAGTCATAATATTCAAAAAATTATTATCTTAGGCGGCCAAGGTAGTAT
GCAAGCTGGTTTAGTGTTAACAAAAATGGGCTTTGAAGTCTTTGGAATAT
TACACACTATTGATAATGATTTTAGTGAAACACAAATGTGTATAGGGGCC
TTAAGTGCTGCTTCTTTTAATCAAAAATTATTAAAGTGCCTAAATTACAC
AGCAAAAGCTCATTGTGCTTTTAATTTAGTTGAGCTTATGGGTCGTGAAT
GTTCATGATTAGTCAATAATAGTGTTGGTAAATTAAAACCTATTTTAATG
TTAACTAATCAAGATAATAAATATACTGTTGATGAAGTAATAGATTTAAT
TAAAGATAAAATAAACTCAATAAAAGAATACGATCCTTTAATCATTGTTC
AAGAATTAATCTATGATCAAAAATGATACGAATTATTAGTAAAAACTTTT
GAGCAAAAATTACATAAAAGTTTACGAATTACAATTTTAAATTATTTACA
ACGCGGAGCTCCAGTAAGTGATTTTGATTTACAATTAGCAAAAGATAGTG
CGAATGTATTGGTTGATTTTATTGTTAATCAAAATGATATAAAAAACACA
AATAATATGTATGTAGTTATTAATAAGTTTGATAATAAGTTAGAAGTTAT
TAAATTCAATAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy