Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR143 IGR141 IGR148 IGR145 IGR146 IGR144 IGR142 IGR147 IGR140 UU180 trpS,syw, - UU175 UU179 UU178 tpiS,tpiA, - UU181 UU177 UU183 eno, - UU184 pyk,pk,kpyK, - UU186 pgm,pgmI, - UU182 UU180 trpS,syw, - UU175 UU179 UU178 tpiS,tpiA, - UU181 UU177 UU183 eno, - UU184 pyk,pk,kpyK, - UU186 pgm,pgmI, - UU182 Type: tandem, Name:  - 116 Type: tandem, Name:  - 113 Type: tandem, Name:  - 118 Type: tandem, Name:  - 114 Type: tandem, Name:  - 115 Type: tandem, Name:  - 117 Type: tandem, Name:  - 119 UU180 trpS,syw, - UU175 UU178 tpiS,tpiA, - UU181 UU177 UU183 eno, - UU184 pyk,pk,kpyK, - UU186 pgm,pgmI, - UU182 UU176 pfkA,pfk-1,k6pF, - UU185 UU176 pfkA,pfk-1,k6pF, - UU185 UU179
* Calculated from Protein Sequence

Gene ID: UU182

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgm  pgmI  

Definition:
phosphoglycerate mutase (2,3-bisphosphoglycerate-independent phosphoglycerate mutase)(BPG-independent PGAM)

Gene Start:
219257

Gene Stop:
220765

Gene Length:
1509

Molecular Weight*:
57383

pI*:
6.90

Net Charge*:
-0.55

EC:
5.4.2.1  

Functional Class:
energy metabolism; glycolysis and gluconeogenesis  

Pathway: pathway table
Glycolysis / Gluconeogenesis

Comment:
This protein is a key enzyme of primary carbon metabolism. The catalytic activity of pgm is the following: 3-Phosphoglycerate to 2-Phosphoglycerate (reversible). By similarity it has been ascertained to have an absolute requirement for manganese (Mn). In B.subtilis this protein is found in an operon containing (in order: pgk, tpi, pgm and eno). See the following gene records for the remaining glycolytic enzymes: UU181 (tpi), UU184 (eno) and UU279 (pgk).

Reference:Comp Biochem Physiol B Biochem Mol Biol. 1995 Oct;112(2):287-93.

Blast Summary:  PSI-Blast Search
A gapped BLAST reveals significant hits to a large number of 2,3-bisphosphoglycerate-independent phosphoglycerate mutase proteins found in other organisms. The most significant hits are to the homologs found in M.genitalium (PMGI_MYCGE) and M.pneumoniae (PMGI_MYCPN). Other significant hits are made against the phosphoglycerate mutase proteins of (but not limited to) B.subtilis (PMGI_BACSU), H.pylori (PMGI_HELPY) and E.coli (PMGI_ECOLI).

A BLAST against the STDPRO database reveals a significant hit to the pgm (phosphoglycerate mutase) protein of M.genitalium (MG430). Residues 3-498 of UU182 are 40% similar to MG430. There were no significant hits to proteins in C.tachomatis or T.pallidum.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0696 is e-gpcM-U.
Cog name: Phosphoglyceromutase/phosphopentomutase.
Functional class: C/G.
BeTs to e-g-cm-u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 7-58, 59-75, 105-123, 136-148, 175-194, 241-254, 296-340, 378-411, 412-437, 446-457 and 470-492 rank in the 100.00th percentile to Block PD02407(A through K repsectively), described as 3-Bisphosphoglycerate-independent Phosphoglycer. The rank of each block ranged from 1 to 14 (with 1 being the best).


ProDom Summary:  Protein Domain Search
Residues 3-491 are 41% similar to a defined domain of PMGI_MYCGE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 3 to 351 (E-value = 3.6e-167) place UU182 in the iPGM_N family which is described as BPG-independent PGAM N-terminus (iPGM_N) (PF06415)
Residues 361 to 474 (E-value = 8.9e-29) place UU182 in the Metalloenzyme family which is described as Metalloenzyme superfamily (PF01676)

PDB Hit:


Gene Protein Sequence:
MKLNKKIGLIIIDGLGIGKEDNTNAVHLANPPTLNYLINNFPTLQISAAQ
QNIGLLENQAGNSEIGHLTIGAGRIILNDNANINNYMKSVDYESAVLSNI
KNEIVHIVGMYSNGLVHSNYEHIHWIIKQIIKNNNQVVLHLISDGRDDYP
YGFAQFIEQINALKKQYNIIVKSLSGRYFAMDRDQRWERTQKAFNAMFVK
QDKICEKTFLEVAQSIANSYKSDEFVQPVVFNDDEKYNLKPHQKVILANY
RSDRMRQLAHLLKPNKKFHYNNPFLVQDVNLITLVPFPDVDAIALFEKQN
LNNTLGDVFNKHQIKEARIAETEKYAHISFFFDGGVNKYYSTKTQYLIPS
QKVATYDLCPQMSAHLITKTIIDHYFDHDVFIVNYANPDMVGHSGNMQQT
IEAILSVDHEIRKLYDFFEKNNGVLMITGDHGNAEMMLDDQKQVITSHSV
NDVWFIITDNKVILNSTQKFSLANIAPTILEYLNIAQPIQMTATSMIKKI
CE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTAAATAAAAAAATAGGTTTGATAATCATTGATGGATTAGGAAT
TGGAAAAGAAGATAATACTAATGCTGTTCATTTAGCAAATCCACCAACAT
TAAATTATTTGATTAATAATTTTCCCACATTACAAATTAGTGCGGCTCAA
CAAAATATTGGTTTACTTGAAAATCAAGCAGGTAACAGCGAAATTGGTCA
TTTAACAATTGGTGCGGGCCGTATCATTTTAAATGATAATGCAAATATTA
ATAATTATATGAAATCCGTTGATTATGAAAGTGCAGTTTTAAGCAATATT
AAAAATGAAATTGTTCATATTGTTGGCATGTATTCGAATGGTTTAGTACA
TAGTAATTATGAACATATTCATTGAATTATTAAACAAATAATTAAAAACA
ATAATCAGGTTGTTTTACATTTAATTTCTGATGGACGAGATGACTATCCT
TATGGTTTTGCTCAATTCATTGAACAAATTAATGCCTTAAAAAAACAATA
TAATATTATTGTAAAGAGTCTAAGTGGGCGTTATTTTGCAATGGATCGTG
ATCAGCGATGAGAACGTACCCAAAAAGCATTTAATGCAATGTTTGTTAAG
CAAGATAAAATATGTGAAAAAACATTTTTAGAGGTTGCACAATCAATCGC
AAATTCTTATAAAAGTGATGAATTTGTTCAACCTGTAGTTTTTAATGATG
ATGAAAAATATAATTTAAAACCACATCAAAAAGTGATTTTAGCAAACTAT
CGTTCAGATCGTATGCGCCAGTTAGCACACTTACTTAAACCTAACAAAAA
ATTTCATTACAATAATCCGTTTTTAGTTCAAGATGTTAATTTAATTACTT
TAGTACCATTCCCTGATGTTGATGCAATAGCTTTATTTGAGAAGCAAAAT
TTAAATAACACTTTAGGTGATGTTTTTAATAAACACCAAATAAAAGAAGC
TCGAATTGCAGAAACAGAAAAATATGCCCATATATCTTTTTTCTTTGATG
GCGGTGTTAATAAATATTATTCGACAAAAACACAATATTTGATTCCTTCG
CAAAAAGTTGCTACTTATGATTTATGTCCCCAAATGTCAGCACATTTAAT
TACGAAAACTATTATCGATCATTATTTCGATCATGATGTTTTTATTGTTA
ATTATGCAAATCCTGATATGGTTGGTCATAGCGGCAATATGCAGCAAACA
ATTGAAGCAATTCTAAGTGTTGACCATGAAATTCGAAAATTATATGATTT
TTTTGAAAAGAATAATGGTGTGTTGATGATTACAGGTGATCATGGAAATG
CTGAAATGATGCTTGATGATCAAAAACAAGTAATTACTTCTCACAGTGTT
AATGATGTTTGGTTTATTATCACAGATAATAAAGTTATTTTAAATTCGAC
ACAAAAATTTAGTTTAGCAAATATTGCTCCAACTATTTTGGAATATTTAA
ATATCGCTCAACCAATTCAAATGACAGCAACGAGTATGATAAAAAAGATT
TGTGAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy