Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR143 IGR141 IGR145 IGR139 IGR146 IGR144 IGR138 IGR142 IGR147 IGR140 UU180 UU174 trpS,syw, - UU175 UU173 UU179 UU178 tpiS,tpiA, - UU181 UU177 UU183 eno, - UU184 pgm,pgmI, - UU182 UU180 UU174 trpS,syw, - UU175 UU173 UU179 UU178 tpiS,tpiA, - UU181 UU177 UU183 eno, - UU184 pgm,pgmI, - UU182 Type: tandem, Name:  - 116 Type: tandem, Name:  - 113 Type: tandem, Name:  - 118 Type: tandem, Name:  - 114 Type: tandem, Name:  - 115 Type: tandem, Name:  - 117 Type: tandem, Name:  - 119 UU180 trpS,syw, - UU175 UU173 UU174 UU178 tpiS,tpiA, - UU181 UU177 UU183 eno, - UU184 pgm,pgmI, - UU182 UU176 pfkA,pfk-1,k6pF, - UU185 UU176 pfkA,pfk-1,k6pF, - UU185 UU179
* Calculated from Protein Sequence

Gene ID: UU181

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tpiS  tpiA  

Definition:
triosephosphate isomerase

Gene Start:
218524

Gene Stop:
219240

Gene Length:
717

Molecular Weight*:
26964

pI*:
6.90

Net Charge*:
-0.28

EC:
5.3.1.1  

Functional Class:
energy metabolism; glycolysis and gluconeogenesis  

Pathway: pathway table
Carbon fixation
Fructose and mannose metabolism
Glycerolipid metabolism
Glycolysis / Gluconeogenesis

Comment:
Taken from Prosite PDOC00155. Triosephosphate isomerase (EC 5.3.1.1) (TIM) is the glycolytic enzyme that catalyzes the reversible interconversion of glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. TIM plays an important role in several metabolic pathways and is essential for efficient energy production. It is a dimer of identical subunits, each of which is made up of about 250 amino-acid residues. A glutamic acid residue is involved in the catalytic mechanism.

In B.subtilis this protein is found in an operon containing (in order: pgk, tpi, pgm and eno). See the following gene records for the remaining glycolytic enzymes: UU182 (pgm), UU184 (eno) and UU279 (pgk).

Reference: Mol Gen Genet. 1984;195(1-2):314-20.

High A+T content at start however BLAST suggests a correct assignment.

Blast Summary:  PSI-Blast Search
A gapped BLAST revealed a number of significant hits to triosephosphate isomerase proteins in various organisms. For example: residues 4-234 were 36% similar to TPIS_MYCHR. Other significant hits were against (but not limited to) the triosephosphate isomerase proteins of M.flocculare(TPIS_MYCFL), M.hyopneumoniae (TPIS_MYCHY), B.aphidicola (TPIS_BUCAP) and M.pneumoniae (TPIS_MYCPN).

A BLAST against the STDPRO database revealed statistically significant hits to proteins found in M.genitalium, C.trachomatis and T.pallidum. Each significant hit was to the TpiA (triosephosphate isomerase) protein of each organism. For example: residues 2-230 were 34% similar to MG431 residues 4-236. Residues 2-236 were 29% similar to residues 26-270 of CT328, and residues 36-230 were 50% similar to residues 39-242 of TP0537.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0149 is ehgpcmyu.
Cog name: Triosephosphate isomerase.
Functional class: C.
BeTs to e-g-cmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 1-12, 59-109, 150-182 and 194-228 rank in the 100.00th percentile to Block BL00171(A,B,C and D respectively), described as Triosephosphate isomerase proteins. The rank of each individual block was as follows: A-4, B-3, C-2, D-1.

Residues 102-125 rank in the 96.04th percentile to Block PR00769I, described as Diphtheria Toxin Signature. However blocks A-H and J did not show a significant alignment or match with the rest of UU181.


ProDom Summary:  Protein Domain Search
Residues 4-234 are 38% similar to a defined domain of TPIS_MYCHR.
Residues 28-96 are 34% similar to a defined domain of TPIS_METJA.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 1 to 238 (E-value = 1.4e-29) place UU181 in the TIM family which is described as Triosephosphate isomerase (PF00121)

PDB Hit:
gi|230405|pdb|1YPI|A Chain A, Triose Phosphate Isomerase (TIM) (E.C.5.3.1.1)

Gene Protein Sequence:
MKYIIANFKMNATQELINHFLNNLTLFDEQKIIIGLAPGDLYLKTFVNLA
EIKKVNLYAQNPSLHNKGPYTGQISCLQLLDINIKNALVGHSEIRIDFSQ
SIIDQKIKISMDLLEQVIICVGETFDAYKQNKSLNFVLNQLANIINYKGL
KKIIIAYEPIWAIGTDLELDFKHINYMIEGIKTYLYNCTGINIPILYGGS
VNDNNINELCNQKLIDGFLIGNASLDVNVFNKIIDKCK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATATATTATTGCTAATTTTAAAATGAATGCAACACAAGAATTAAT
TAATCATTTTTTAAATAATTTAACGTTATTTGATGAGCAAAAAATTATTA
TTGGTTTAGCACCAGGGGATTTATATTTAAAAACATTTGTTAATTTAGCT
GAAATAAAAAAAGTCAATTTATATGCTCAAAACCCATCATTACATAATAA
AGGACCTTATACAGGTCAAATAAGTTGTTTACAATTATTAGATATTAATA
TTAAAAATGCTTTAGTTGGGCATAGTGAAATACGTATTGATTTTTCACAA
TCAATAATTGATCAAAAAATAAAAATATCTATGGATTTATTAGAACAAGT
CATCATTTGTGTTGGCGAAACTTTTGATGCTTATAAACAAAATAAATCAC
TTAATTTTGTTTTAAATCAATTAGCCAACATCATTAATTACAAAGGATTA
AAAAAAATTATTATCGCTTATGAACCAATTTGAGCAATTGGCACTGATTT
AGAATTAGATTTTAAACATATTAATTACATGATCGAAGGAATTAAAACAT
ATTTATATAATTGTACTGGAATAAATATTCCTATTTTATATGGCGGTAGT
GTTAATGACAATAATATTAATGAATTGTGCAATCAAAAATTAATCGATGG
TTTTTTAATTGGCAATGCTTCATTAGATGTTAATGTTTTTAATAAAATTA
TCGATAAATGTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy