Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR143 IGR141 IGR145 IGR139 IGR146 IGR144 IGR138 IGR142 IGR147 IGR140 UU180 UU174 trpS,syw, - UU175 UU173 UU179 UU178 tpiS,tpiA, - UU181 UU177 UU183 eno, - UU184 pgm,pgmI, - UU182 UU180 UU174 trpS,syw, - UU175 UU173 UU179 UU178 tpiS,tpiA, - UU181 UU177 UU183 eno, - UU184 pgm,pgmI, - UU182 Type: tandem, Name:  - 114 Type: tandem, Name:  - 119 Type: tandem, Name:  - 113 Type: tandem, Name:  - 117 Type: tandem, Name:  - 111 Type: tandem, Name:  - 118 Type: tandem, Name:  - 116 Type: tandem, Name:  - 112 Type: tandem, Name:  - 115 UU180 UU174 trpS,syw, - UU175 UU173 UU178 tpiS,tpiA, - UU181 UU177 UU183 eno, - UU184 pgm,pgmI, - UU182 UU176 UU176 UU179
* Calculated from Protein Sequence

Gene ID: UU178

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
probable PTS glucose-specific permease

Gene Start:
217298

Gene Stop:
217678

Gene Length:
381

Molecular Weight*:
14301

pI*:
10.10

Net Charge*:
7.08

EC:
2.7.1.69  

Functional Class:
transport and binding proteins; carbohydrates, organic alcohols, and acids  

Pathway: pathway table
Aminosugars metabolism
Fructose and mannose metabolism
Galactose metabolism
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism

Comment:
Probable glucose specific PTS C component.

Notice EC# and other assertions made are based on numerous subthreshold hits.
High A+T content in 3' half of cds. High A+T at 5' end may suggest
false start, however orthologs also display a dissimilar "leader" sequence.

Blast Summary:  PSI-Blast Search
A gapped BLAST reveals two significant hits, one to MG129 (a suspected ptsG sequence) and the other to the MG129 homolog in M.pneumoniae
(2496310). Subthreshold hits are best to PTS sequences. Residues 12-123 are 35% similar to residues 4-116 of MG129. No significant similarity to C.trachomatis or T.pallidum.



COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
Residues 59-98 rank in the 91.29th percentile to Block BL01035A, described as PTS EIIB domain proteins cysteine phosphorylation site proteins proteins. Block A has a rank of 1, however there is no significant alignment or similarity to block B.

ProDom Summary:  Protein Domain Search
Residues 12-123 are 35% similar to a defined domain of Y129_MYCGE.
Residues 12-110 are 28% similar to a defined domain of Q53922_STACA, described as: COMPONENT SYSTEM PHOSPHOTRANSFERASE PTS IIABC ENZYME II IIBC PERMEASE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
31
coil-coil  
65  
95

PDB Hit:
gi|1827648|pdb|1IBA| Glucose Permease (Domain Iib), Nmr, 11 Structures

Gene Protein Sequence:
MQNLNNKQKTLIIFLGIITFGIFIIYFFTKAKKVSQIRNTHLIVSSNIPF
SLNDFYNCIGSKNNLVNVDATINTLKIELKEINALNNEKLKVLGAKGIMC
NQTKISIIFGDFCLELKELIKKDLFS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAAATTTAAATAATAAGCAAAAAACATTAATTATTTTTTTAGGTAT
TATTACCTTTGGAATTTTTATTATTTACTTTTTTACAAAAGCTAAAAAAG
TATCTCAAATTAGAAACACTCATTTAATAGTATCTTCAAATATTCCTTTT
AGTTTAAATGATTTTTATAATTGTATTGGTTCAAAAAATAATTTAGTTAA
CGTTGATGCGACAATTAATACATTAAAAATTGAATTAAAAGAAATTAACG
CATTGAATAATGAAAAATTAAAGGTTTTAGGTGCAAAAGGGATTATGTGC
AATCAAACAAAAATTTCTATTATTTTTGGTGATTTTTGTTTGGAACTTAA
AGAATTAATTAAAAAAGATTTATTTTCATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy