Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR121 IGR113 IGR115 IGR114 IGR118 IGR117 IGR120 IGR116 IGR119 atpD,atpH-2, - UU133 atpL, - UU136 atpI, - UU138 atpD,atpH-1, - UU134 atpF, - UU135 UU131 atp6, - UU137 atpA, - UU132 UU139 ftsY, - UU141 p115, - UU140 atpD,atpH-2, - UU133 atpL, - UU136 atpI, - UU138 atpD,atpH-1, - UU134 atpF, - UU135 UU131 atp6, - UU137 atpA, - UU132 UU139 ftsY, - UU141 p115, - UU140 Type: tandem, Name:  - 104 Type: tandem, Name:  - 399 Type: tandem, Name:  - 103 Type: tandem, Name:  - 107 Type: tandem, Name:  - 101 Type: tandem, Name:  - 108 Type: tandem, Name:  - 106 Type: tandem, Name:  - 102 Type: tandem, Name:  - 105 atpD,atpH-2, - UU133 atpL, - UU136 atpI, - UU138 atpD,atpH-1, - UU134 atpF, - UU135 UU131 atp6, - UU137 atpA, - UU132 UU139 ftsY, - UU141 p115, - UU140
* Calculated from Protein Sequence

Gene ID: UU137

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atp6  

Definition:
ATP synthase A chain

Gene Start:
178171

Gene Stop:
177344

Gene Length:
828

Molecular Weight*:
30249

pI*:
9.80

Net Charge*:
6.58

EC:
3.6.1.34  

Functional Class:
energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Oxidative phosphorylation

Primary Evidence:
Nagata K, Takagi E, Satoh H, Okamura H, Tamura T. 1995. Growth inhibition of Ureaplasma urealyticum by the proton pump inhibitor lansoprazole: direct attribution to inhibition by lansoprazole of urease activity and urea-induced ATP synthesis in U. urealyticum. Antimicrob Agents Chemother 39(10):2187-92. Medline: 8619564.

Smith DG, Russell WC, Ingledew WJ, Thirkell D. 1993. Hydrolysis of urea by Ureaplasma urealyticum generates a transmembrane potential with resultant ATP synthesis. J Bacteriol. 175(11):3253-8. Medline: 8501029.

Romano N, La Licata R, Russo Alesi D. 1986. Energy Production in Ureaplasma urealyticum. Pediatr Infect Dis. 5(6 Suppl):S308-12. Medline: 3797330.

Secondary Evidence:
Das A, Ljungdahl LG. 1997. Composition and primary structure of the F1F0 ATP synthase from the obligately anaerobic bacterium Clostridium thermoaceticum. J Bacteriol 179(11):3746-55. Medline: 9171425.

Rasmussen OF, Shirvan MH, Margalit H, Christiansen C, Rottem S. 1992. Nucleotide sequence, organization and characterization of the atp genes and the encoded subunits of Mycoplasma gallisepticum ATPase. Biochem J. 285(Pt 3):881-8. Medline: 1386735.

Comment:
This gene is part of a cluster encompassing records UU128-UU138. The products of these genes are responsible for the ATP synthase complex, generation of ATP from ADP and Pi.

The complete list of predicted ATP synthases in U.u. is: UU053, UU054, UU128, UU129, UU130, UU132, UU133, UU134, UU135, UU136, UU137, and UU138.

This gene cluster is a likely candidate for the ATP synthase activity seen in conjunction with the urease present in Ureaplasma urealyticum (see UU427-UU434).

From: Molecular Biology and Pathogenicity of Mycoplasmas, Microbiology and Molecular Biology Reviews, Dec. 1998, p.1118-1119.Shmuel Razin, David Yogev, and Yehudith Naot.

The dependence of ureaplasmas on urea for growth has led to the hypothesis that intracellular urea hydrolysis and the resulting intracellular accumulation of ammonia/ammonium ions is coupled to ATP synthesis through a chemiosmotic type of mechanism. Experimental support for the generation of a transmembrane potential, with resultant ATP synthesis through the ureaplasmal F0F1-type ATPase, first provided by Romano et al. (1986, Medline: 3797330) was more recently extended and confirmed by Smith et al. (1993, Medline: 8501029) [...] It is worth mentioning at this point that the pH of the urogenital tract is usually on the acidic side of neutrality, corresponding to the pH values optimal for ureaplasma growth, maximum increase in delta P, maximum ammonia chemical potential, maximum urease activity, and maximum ATP generation.

Blast Summary:  PSI-Blast Search
A gapped BLAST reveals significant hits to a number of ATP synthase A chain proteins. For example: residues 10-235 are 29% similar to residues 39-275 of ATP6_MYCGA, and residues 10-230 are 25% similar to residues 34-264 of ATP6_MYCPN.

A BLAST against the STDPRO database reveals a significant hit to MG405, described as AtpB, where residues 16-257 are 29% similar to residues 40-292 of MG405. No significant similarity to C.trachomatis or T.pallidum.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0356 is ehgpc--u.
Cog name: ATP synthase A subunit.
Functional class: C.
BeTs to e--pc--u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 75-102, 143-178 and 210-232 rank in the 99.74th percentile to Block BL00449(A,B and C respectively), described as ATP synthase a subunit proteins.

ProDom Summary:  Protein Domain Search
Residues 80-179 are 37% similar, and residues 10-72 are 28% similar to a defined domain of ATP6_MYCGA.



Paralogs:  Local Blast Search
No paralogously related proteins found in the genome of U.urealyticum.

Pfam Summary:  Pfam Search
Residues 72 to 232 (E-value = 1.7e-18) place UU137 in the ATP-synt_A family which is described as ATP synthase A chain (PF00119)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
11  
36
transmembrane  
48  
64
transmembrane  
78  
102
transmembrane  
107  
136
transmembrane  
141  
166
transmembrane  
170  
196
transmembrane  
200  
227
non-globular  
232  
275

PDB Hit:


Gene Protein Sequence:
VENYSPLDIMIALPHIAAIIMVTLIIGTVSLIYFSMVKKLTVHDVPNRFV
IIIGMIVDYFRGLVVDTMGAKHVKLAPYVLFTFCYIFTANLVSLFGFKEA
TTASAVPLAMALGTVIGGQIVALKYQKASFFLKFAFKIKGFPIMINPLEI
VSKLTPIISLTFRLWGNISAAAILLNITYWAFAGFTNVVPWVGVSLIAAV
VILPILIGYFTCFAGTIQAFVFTLLTSINWGLEIKEGEEHHAHLAHKKAE
KLAAKKLAELDTQNQIQNNEAQVVL$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGAAAATTATAGCCCGCTTGATATAATGATTGCACTTCCACATATTGC
TGCAATCATTATGGTAACTTTAATTATTGGAACAGTTTCGTTGATTTATT
TTAGTATGGTTAAAAAGTTAACTGTACATGATGTGCCAAACCGTTTTGTA
ATTATTATTGGAATGATTGTTGATTATTTTAGAGGACTAGTTGTTGATAC
AATGGGCGCTAAACATGTTAAATTAGCACCTTATGTACTATTTACATTTT
GTTATATTTTTACAGCTAACTTAGTTTCTTTATTTGGTTTCAAAGAAGCA
ACAACTGCATCTGCCGTTCCATTAGCAATGGCTCTTGGAACCGTGATCGG
TGGTCAAATTGTTGCCTTAAAATACCAAAAAGCTTCATTCTTTTTAAAAT
TTGCTTTTAAAATTAAAGGTTTTCCAATTATGATAAACCCTTTGGAAATC
GTTTCTAAATTAACCCCTATTATTTCATTAACATTCCGTTTATGAGGTAA
TATCTCTGCTGCTGCAATTTTATTAAACATAACATATTGAGCATTTGCAG
GTTTTACAAACGTAGTTCCTTGAGTTGGTGTATCATTAATTGCTGCAGTA
GTAATTTTACCAATCTTAATTGGTTATTTTACTTGTTTTGCAGGAACAAT
TCAAGCTTTTGTATTTACATTATTAACAAGTATTAACTGAGGTCTTGAAA
TCAAAGAAGGTGAAGAACACCACGCTCATCTTGCGCATAAAAAAGCCGAA
AAACTTGCTGCTAAAAAATTAGCAGAACTTGATACTCAAAATCAAATTCA
AAATAATGAGGCTCAAGTAGTTTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy