Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR112 IGR113 IGR115 IGR114 IGR118 IGR117 IGR120 IGR116 IGR119 atpD,atpH-2, - UU133 atpL, - UU136 atpI, - UU138 atpD,atpH-1, - UU134 atpF, - UU135 UU131 atp6, - UU137 atpG, - UU130 atpA, - UU132 UU139 p115, - UU140 atpD,atpH-2, - UU133 atpL, - UU136 atpI, - UU138 atpD,atpH-1, - UU134 atpF, - UU135 UU131 atp6, - UU137 atpG, - UU130 atpA, - UU132 UU139 p115, - UU140 Type: tandem, Name:  - 104 Type: tandem, Name:  - 399 Type: tandem, Name:  - 103 Type: tandem, Name:  - 107 Type: tandem, Name:  - 101 Type: tandem, Name:  - 108 Type: tandem, Name:  - 106 Type: tandem, Name:  - 102 Type: tandem, Name:  - 105 atpD,atpH-2, - UU133 atpL, - UU136 atpI, - UU138 atpD,atpH-1, - UU134 atpF, - UU135 atp6, - UU137 atpG, - UU130 atpA, - UU132 UU131 UU139 p115, - UU140
* Calculated from Protein Sequence

Gene ID: UU136

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpL  

Definition:
ATP synthase C chain

Gene Start:
177295

Gene Stop:
176966

Gene Length:
330

Molecular Weight*:
11001

pI*:
4.80

Net Charge*:
-1.78

EC:
3.6.1.34  

Functional Class:
energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Oxidative phosphorylation

Primary Evidence:
Nagata K, Takagi E, Satoh H, Okamura H, Tamura T. 1995. Growth inhibition of Ureaplasma urealyticum by the proton pump inhibitor lansoprazole: direct attribution to inhibition by lansoprazole of urease activity and urea-induced ATP synthesis in U. urealyticum. Antimicrob Agents Chemother 39(10):2187-92. Medline: 8619564.

Smith DG, Russell WC, Ingledew WJ, Thirkell D. 1993. Hydrolysis of urea by Ureaplasma urealyticum generates a transmembrane potential with resultant ATP synthesis. J Bacteriol. 175(11):3253-8. Medline: 8501029.

Romano N, La Licata R, Russo Alesi D. 1986. Energy Production in Ureaplasma urealyticum. Pediatr Infect Dis. 5(6 Suppl):S308-12. Medline: 3797330.

Secondary Evidence:
Das A, Ljungdahl LG. 1997. Composition and primary structure of the F1F0 ATP synthase from the obligately anaerobic bacterium Clostridium thermoaceticum. J Bacteriol 179(11):3746-55. Medline: 9171425.

Rasmussen OF, Shirvan MH, Margalit H, Christiansen C, Rottem S. 1992. Nucleotide sequence, organization and characterization of the atp genes and the encoded subunits of Mycoplasma gallisepticum ATPase. Biochem J. 285(Pt 3):881-8. Medline: 1386735.

Comment:
This gene is part of a cluster encompassing records UU128-UU138. The products of these genes are responsible for the ATP synthase complex, generation of ATP from ADP and Pi.

The complete list of predicted ATP synthases in U.u. is: UU053, UU054, UU128, UU129, UU130, UU132, UU133, UU134, UU135, UU136, UU137, and UU138.

This gene cluster is a likely candidate for the ATP synthase activity seen in conjunction with the urease present in Ureaplasma urealyticum (see UU427-UU434).

From: Molecular Biology and Pathogenicity of Mycoplasmas, Microbiology and Molecular Biology Reviews, Dec. 1998, p.1118-1119.Shmuel Razin, David Yogev, and Yehudith Naot.

The dependence of ureaplasmas on urea for growth has led to the hypothesis that intracellular urea hydrolysis and the resulting intracellular accumulation of ammonia/ammonium ions is coupled to ATP synthesis through a chemiosmotic type of mechanism. Experimental support for the generation of a transmembrane potential, with resultant ATP synthesis through the ureaplasmal F0F1-type ATPase, first provided by Romano et al. (1986, Medline: 3797330) was more recently extended and confirmed by Smith et al. (1993, Medline: 8501029) [...] It is worth mentioning at this point that the pH of the urogenital tract is usually on the acidic side of neutrality, corresponding to the pH values optimal for ureaplasma growth, maximum increase in delta P, maximum ammonia chemical potential, maximum urease activity, and maximum ATP generation.

Blast Summary:  PSI-Blast Search
A gapped BLAST reveals significant hits to a number of ATP Synthase C Chain proteins. For example: residues 39-109 are 45% similar to ATPL_MYCPN, and residues 38-109 are 50% similar to ATPL_MYCGA. Other significant hits were found against (but were not limited to) the ATP synthase C chains of: A.woodii (1488060), P.modestum (ATPL_PROMO), C.acetobutylicum (1905950) and A.aeolicus (ATPL_AQUAE).

A BLAST against the STDPRO database reveals a significant hit to MG404, described as AtpE, where residues 37-109 are 46% similar to residues 28-100 of MG404. No significant similarity to C.trachomatis or T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0636 is ehgpcm-u.
Cog name: ATP synthase E subunit.
Functional class: C.
BeTs to -hg-cm-u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 47-100, 51-104 and 56-109 rank in the 99.97th percentile to Block BL00605, described as ATP synthase c subunit proteins.

Residues 85-109, 57-83, 84-107 and 80-103 rank in the 99.70th percentile to Block PR00122(B,C,D and D respectively) described as Vacuolar ATP Synthase 16 KD Subunit Signature.


ProDom Summary:  Protein Domain Search
Residues 66-107 are 50% similar to a defined domain of O08310_CLOAB, an ATP synthase C chain.

Paralogs:  Local Blast Search
Residues 25-105 are 29% similar to residues 50-129 of UU400.

Pfam Summary:  Pfam Search
Residues 40 to 108 (E-value = 1.3e-21) place UU136 in the ATP-synt_C family which is described as ATP synthase subunit C (PF00137)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
35  
62
transmembrane  
82  
109

PDB Hit:


Gene Protein Sequence:
MSSFIDITNVISSHIEANLPAIASENVGSLANGAGIAYLGKYIGTGITML
AAGAVGLMQGFSTANAVQAVARNPEAQPKILSTMIVGLALAEAVAIYALI
VSILIIFVA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCATCATTTATTGATATTACAAATGTTATTTCATCACATATTGAAGC
TAATTTACCAGCAATTGCTTCTGAAAATGTAGGTTCACTTGCAAACGGTG
CAGGAATTGCTTACTTAGGTAAATATATTGGTACAGGAATTACAATGTTA
GCAGCTGGTGCAGTTGGTTTAATGCAAGGTTTTTCTACAGCTAATGCTGT
ACAAGCTGTAGCTCGTAACCCAGAAGCACAACCAAAGATTTTAAGTACAA
TGATTGTTGGTTTAGCATTGGCTGAAGCTGTTGCTATTTATGCACTTATT
GTTTCTATCTTAATTATTTTCGTTGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy