Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR112 IGR113 IGR115 IGR114 IGR118 IGR117 IGR120 IGR116 IGR119 atpD,atpH-2, - UU133 atpL, - UU136 atpI, - UU138 atpD,atpH-1, - UU134 atpF, - UU135 UU131 atp6, - UU137 atpG, - UU130 atpA, - UU132 UU139 p115, - UU140 atpD,atpH-2, - UU133 atpL, - UU136 atpI, - UU138 atpD,atpH-1, - UU134 atpF, - UU135 UU131 atp6, - UU137 atpG, - UU130 atpA, - UU132 UU139 p115, - UU140 Type: tandem, Name:  - 104 Type: tandem, Name:  - 101 Type: tandem, Name:  - 106 Type: tandem, Name:  - 102 Type: tandem, Name:  - 103 Type: tandem, Name:  - 105 Type: tandem, Name:  - 107 atpD,atpH-2, - UU133 atpL, - UU136 atpI, - UU138 atpD,atpH-1, - UU134 atpF, - UU135 UU131 atp6, - UU137 atpG, - UU130 atpA, - UU132 UU139 p115, - UU140
* Calculated from Protein Sequence

Gene ID: UU135

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpF  

Definition:
ATP synthase B chain

Gene Start:
176897

Gene Stop:
176280

Gene Length:
618

Molecular Weight*:
23201

pI*:
5.30

Net Charge*:
-3.59

EC:
3.6.1.34  

Functional Class:
energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Oxidative phosphorylation

Primary Evidence:
Nagata K, Takagi E, Satoh H, Okamura H, Tamura T. 1995. Growth inhibition of Ureaplasma urealyticum by the proton pump inhibitor lansoprazole: direct attribution to inhibition by lansoprazole of urease activity and urea-induced ATP synthesis in U. urealyticum. Antimicrob Agents Chemother 39(10):2187-92. Medline: 8619564.

Smith DG, Russell WC, Ingledew WJ, Thirkell D. 1993. Hydrolysis of urea by Ureaplasma urealyticum generates a transmembrane potential with resultant ATP synthesis. J Bacteriol. 175(11):3253-8. Medline: 8501029.

Romano N, La Licata R, Russo Alesi D. 1986. Energy Production in Ureaplasma urealyticum. Pediatr Infect Dis. 5(6 Suppl):S308-12. Medline: 3797330.

Secondary Evidence:
Das A, Ljungdahl LG. 1997. Composition and primary structure of the F1F0 ATP synthase from the obligately anaerobic bacterium Clostridium thermoaceticum. J Bacteriol 179(11):3746-55. Medline: 9171425.

Rasmussen OF, Shirvan MH, Margalit H, Christiansen C, Rottem S. 1992. Nucleotide sequence, organization and characterization of the atp genes and the encoded subunits of Mycoplasma gallisepticum ATPase. Biochem J. 285(Pt 3):881-8. Medline: 1386735.

Comment:
The B chain, along with the A and C chains, forms the CF(0) component (membrane proton channel) of F-type ATP Synthases.

This gene is part of a cluster encompassing records UU128-UU138. The products of these genes are responsible for the ATP synthase complex, generation of ATP from ADP and Pi.

The complete list of predicted ATP synthases in U.u. is: UU053, UU054, UU128, UU129, UU130, UU132, UU133, UU134, UU135, UU136, UU137, and UU138.

This gene cluster is a likely candidate for the ATP synthase activity seen in conjunction with the urease present in Ureaplasma urealyticum (see UU427-UU434).

From: Molecular Biology and Pathogenicity of Mycoplasmas, Microbiology and Molecular Biology Reviews, Dec. 1998, p.1118-1119.Shmuel Razin, David Yogev, and Yehudith Naot.

The dependence of ureaplasmas on urea for growth has led to the hypothesis that intracellular urea hydrolysis and the resulting intracellular accumulation of ammonia/ammonium ions is coupled to ATP synthesis through a chemiosmotic type of mechanism. Experimental support for the generation of a transmembrane potential, with resultant ATP synthesis through the ureaplasmal F0F1-type ATPase, first provided by Romano et al. (1986, Medline: 3797330) was more recently extended and confirmed by Smith et al. (1993, Medline: 8501029) [...] It is worth mentioning at this point that the pH of the urogenital tract is usually on the acidic side of neutrality, corresponding to the pH values optimal for ureaplasma growth, maximum increase in delta P, maximum ammonia chemical potential, maximum urease activity, and maximum ATP generation.

Blast Summary:  PSI-Blast Search
A gapped BLAST reveals significant hits to a number of ATP synthase B chain proteins. For example: residues 26-2014 are 31% similar to ATPF_MYCGA, residues 27-201 are 28% similar to ATPF_MYCPN. Significant hits are also made (but not limited) to the ATP synthase B chains of S.faecalis (ATPF_ENTHR), M.thermoacetica (1929509), B.subtilis (ATPF_BACSU), B.megaterium (ATPF_BACME) and T.ferrooxidans (ATPF_THIFE).

A BLAST against the STDPRO database reveals a significant hit to MG403, described as atpF, where residues 6-204 of UU135 are 34% similar to residues 5-204 of MG403. No significant similarity to C.trachomatis or T.pallidum.


COGS Summary:  COGS Search
No COG found in manual search. The following found automatically:

The phylogenetic pattern of COG0711C is ehgpc--u.
Cog name: Replicative DNA helicase.
Functional class: L.
BeTs to ---p----.
Number of proteins in this genome belonging to this COG is 2



Blocks Summary:  Blocks Search
Residues 51-93 and 55-97 rank in the 99.76th percentile to Block PF00430, described as ATP synthase B/B' CF(0).

ProDom Summary:  Protein Domain Search
Residues 13-204 are 34% similar to a defined domain of ATPF_MYCGE.
Residues 55-184 are 26% similar to a defined domain of ATPF_STRLI.
Residues 790167 are 26% similar to a defined domain of ATPF_BACME.

Paralogs:  Local Blast Search
No paralogously related proteins found in U.urealyticum.

Pfam Summary:  Pfam Search
Residues 50 to 181 (E-value = 5.3e-21) place UU135 in the ATP-synt_B family which is described as ATP synthase B/B' CF(0) (PF00430)

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
31
transmembrane  
42  
69
coil-coil  
74  
195

PDB Hit:


Gene Protein Sequence:
MKLNKKHLVAILSVLSLSIIVVPLLTSCTGDIPELNPAEIINTLFPNVWV
FIAQVIAMCVVFSLVLWLVWKPTNKMLDKRREYIAKEITDAENAKQEALQ
YLENAKSEHLAAQAQTLEIIAKAKSESLTLRESLEKEAREAADKIISSAK
ISIANERRENLERLQSEAREAAYIAAEALMKKELSREDNDKLVDQFIKEL
ENNEK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTAAATAAAAAGCATTTAGTAGCTATATTATCCGTTCTTTCTTT
ATCAATTATAGTTGTACCACTGTTGACTTCATGTACTGGTGATATTCCAG
AATTAAATCCAGCAGAGATTATTAATACACTATTCCCTAATGTATGAGTA
TTTATAGCTCAAGTTATTGCAATGTGTGTCGTTTTTTCATTAGTATTATG
ATTGGTATGAAAACCAACAAATAAAATGCTAGATAAAAGACGTGAATATA
TTGCTAAAGAAATTACAGATGCAGAAAATGCTAAACAAGAAGCTTTACAA
TATTTAGAAAACGCTAAATCTGAACATTTAGCAGCACAAGCACAAACGTT
AGAAATTATTGCAAAAGCTAAAAGTGAATCATTAACTTTACGTGAATCAT
TAGAAAAAGAAGCACGTGAAGCTGCTGATAAAATTATTAGTTCTGCTAAA
ATTAGCATTGCTAATGAACGTAGAGAAAATCTTGAACGTTTACAATCTGA
AGCTCGTGAAGCTGCTTATATTGCAGCTGAAGCATTGATGAAAAAAGAAT
TGTCTAGAGAAGATAATGATAAACTAGTTGATCAATTCATTAAAGAATTA
GAAAATAATGAAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy