Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR112 IGR113 IGR115 IGR114 IGR118 IGR111 IGR117 IGR120 IGR116 IGR119 atpD,atpH-2, - UU133 atpL, - UU136 atpI, - UU138 atpD,atpH-1, - UU134 atpF, - UU135 UU131 atp6, - UU137 atpG, - UU130 atpB, - UU129 atpA, - UU132 UU139 p115, - UU140 atpD,atpH-2, - UU133 atpL, - UU136 atpI, - UU138 atpD,atpH-1, - UU134 atpF, - UU135 UU131 atp6, - UU137 atpG, - UU130 atpB, - UU129 atpA, - UU132 UU139 p115, - UU140 Type: tandem, Name:  - 104 Type: tandem, Name:  - 101 Type: tandem, Name:  - 102 Type: tandem, Name:  - 103 atpD,atpH-2, - UU133 atpL, - UU136 atpI, - UU138 atpD,atpH-1, - UU134 atpF, - UU135 UU131 atp6, - UU137 atpG, - UU130 atpB, - UU129 atpA, - UU132 UU139 p115, - UU140
* Calculated from Protein Sequence

Gene ID: UU133

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpD  atpH-2  

Definition:
ATP synthase delta chain

Gene Start:
175727

Gene Stop:
175428

Gene Length:
300

Molecular Weight*:
11308

pI*:
10.70

Net Charge*:
7.99

EC:
3.6.1.34  

Functional Class:
energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Oxidative phosphorylation

Comment:
F-type ATPases have 2 components, CF(1) - the catalytic core and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1), while CF(0) has three main subunits: A, B and C.

Function: This protein seems to be part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) into CF(1) or is implicated in proton conduction.

This gene is part of a cluster encompassing records UU128-UU138. The products of these genes are responsible for the ATP synthase complex, generation of ATP from ADP and Pi.

The complete list of predicted ATP synthases in U.u. is: UU053, UU054, UU128, UU129, UU130, UU132, UU133, UU134, UU135, UU136, UU137, and UU138.

This gene cluster is a likely candidate for the ATP synthase activity seen in conjunction with the urease present in Ureaplasma urealyticum (see UU427-UU434).

From: Molecular Biology and Pathogenicity of Mycoplasmas, Microbiology and Molecular Biology Reviews, Dec. 1998, p.1118-1119.Shmuel Razin, David Yogev, and Yehudith Naot.

The dependence of ureaplasmas on urea for growth has led to the hypothesis that intracellular urea hydrolysis and the resulting intracellular accumulation of ammonia/ammonium ions is coupled to ATP synthesis through a chemiosmotic type of mechanism. Experimental support for the generation of a transmembrane potential, with resultant ATP synthesis through the ureaplasmal F0F1-type ATPase, first provided by Romano et al. (1986, Medline: 3797330) was more recently extended and confirmed by Smith et al. (1993, Medline: 8501029) [...] It is worth mentioning at this point that the pH of the urogenital tract is usually on the acidic side of neutrality, corresponding to the pH values optimal for ureaplasma growth, maximum increase in delta P, maximum ammonia chemical potential, maximum urease activity, and maximum ATP generation.

NOTE: There are two genes encoding for proteins that show significant homology to AtpH proteins. Whether both of these proteins are needed for ATP synthase function, or if they act as a heterodimer remains to be experimentally derived. The fact that both proteins only have a partial domain according to Pfam may indicate that they act as a heterodimer within the ATP synthase complex.

Blast Summary:  PSI-Blast Search
A gapped BLAST reveals two significant hits. Residues 17-87 of UU133 are 36% similar to residues 97-167 of the ATP synthase delta chain of M.gallisepticum (ATPD_MYCGA), and residues 30-92 are 36% similar to residues 113-176 of the ATP synthase delta chain of S.faecalis (ATPD_ENTHR).

On the fourth iteration of PSI-BLAST the alignment reached convergance and significant hits were found against a number of ATP synthase delta chains. For example: residues 1-96 are 25% similar to residues 80-177 of ATPD_VIBAL (V.alginolyticus), residues 1-98 are 26% similar to residues 87-186 of ATPD_RHOBL (R.blasticus), residues 1-96 are 19% similar to residues 80-177 of ATPD_ECOLI (E.coli). Other significant hits were found to ATP synthase delta subunits in both prokaryotic and eukaryotic organisms.

A BLAST against the STDPRO database reveals a significant hit to MG402, described as AtpH. UU133 residues 26-91 are 59% similar to residues 107-172 of MG402. No significant hits to T.pallidum or C.trachomatis.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0712 is ehgpc-y-.
Cog name: ATP synthase delta subunit.
Functional class: C.
BeTs to ---pc---.
Number of proteins in this genome belonging to this COG is 2



Blocks Summary:  Blocks Search
Residues 53-90 rank in the 99.70th percentile to Block BL00389C, described as ATP synthase delta (OSCP) subunit proteins.

ProDom Summary:  Protein Domain Search
Residues 17-87 are 36% similar to a defined domain of ATPD_MYCGA.


Paralogs:  Local Blast Search
UU133 is paralogously related to UU134, an ATP synthase delta chain, where residues 4-91 of UU133 are 32% similar to residues 84-175 of UU134.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MQSNTKLAKYSKIIANRLKAYSNQTRFIEIKTAFELNDEQKQRIKKTVIS
RFGDERPIKFIVDPSLIGGISLKINLEIIDSSLKTKLNQIINTKEKEGA$


Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAAGTAATACTAAACTAGCAAAATATTCAAAAATTATCGCCAATCG
TTTAAAAGCATATTCTAATCAAACTCGTTTTATTGAAATTAAAACTGCTT
TTGAATTGAATGATGAACAAAAACAAAGAATTAAAAAAACTGTTATTAGT
CGTTTTGGCGATGAAAGACCCATTAAATTTATCGTTGATCCATCATTAAT
TGGTGGTATATCATTAAAAATCAACTTGGAAATAATTGATTCTTCTCTAA
AAACAAAACTAAATCAAATCATCAATACGAAAGAGAAAGAAGGTGCGTAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy