Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR112 IGR113 IGR115 IGR114 IGR111 IGR109 IGR110 atpD,atpH-2, - UU133 UU127 atpE, - UU128 atpD,atpH-1, - UU134 atpF, - UU135 UU131 atpG, - UU130 atpB, - UU129 atpA, - UU132 UU126 atpD,atpH-2, - UU133 UU127 atpE, - UU128 atpD,atpH-1, - UU134 atpF, - UU135 UU131 atpG, - UU130 atpB, - UU129 atpA, - UU132 UU126 Type: tandem, Name:  - 97 Type: tandem, Name:  - 96 Type: tandem, Name:  - 100 Type: tandem, Name:  - 94 Type: tandem, Name:  - 101 Type: tandem, Name:  - 99 Type: tandem, Name:  - 95 Type: tandem, Name:  - 98 atpD,atpH-2, - UU133 UU127 atpE, - UU128 atpD,atpH-1, - UU134 atpF, - UU135 UU131 atpG, - UU130 atpB, - UU129 atpA, - UU132 UU126
* Calculated from Protein Sequence

Gene ID: UU130

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpG  

Definition:
ATP synthase gamma chain

Gene Start:
172218

Gene Stop:
171358

Gene Length:
861

Molecular Weight*:
32282

pI*:
9.40

Net Charge*:
4.64

EC:
3.6.1.34  

Functional Class:
energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Oxidative phosphorylation

Primary Evidence:
Nagata K, Takagi E, Satoh H, Okamura H, Tamura T. 1995. Growth inhibition of Ureaplasma urealyticum by the proton pump inhibitor lansoprazole: direct attribution to inhibition by lansoprazole of urease activity and urea-induced ATP synthesis in U. urealyticum. Antimicrob Agents Chemother 39(10):2187-92. Medline: 8619564.

Smith DG, Russell WC, Ingledew WJ, Thirkell D. 1993. Hydrolysis of urea by Ureaplasma urealyticum generates a transmembrane potential with resultant ATP synthesis. J Bacteriol. 175(11):3253-8. Medline: 8501029.

Romano N, La Licata R, Russo Alesi D. 1986. Energy Production in Ureaplasma urealyticum. Pediatr Infect Dis. 5(6 Suppl):S308-12. Medline: 3797330.

Secondary Evidence:
Das A, Ljungdahl LG. 1997. Composition and primary structure of the F1F0 ATP synthase from the obligately anaerobic bacterium Clostridium thermoaceticum. J Bacteriol 179(11):3746-55. Medline: 9171425.

Rasmussen OF, Shirvan MH, Margalit H, Christiansen C, Rottem S. 1992. Nucleotide sequence, organization and characterization of the atp genes and the encoded subunits of Mycoplasma gallisepticum ATPase. Biochem J. 285(Pt 3):881-8. Medline: 1386735.

Comment:
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. F-type ATPases have 2 components: CF(1) - the catalytic core and CF(0) - the membrane proton channel. CF(1) has five subunits: Alpha(3), Beta(3), Gamma(1), Delta(1) and Epsilon(1). CF(0) has three main subunits: A, B and C.

This gene is part of a cluster encompassing records UU128-UU138. The products of these genes are responsible for the ATP synthase complex, generation of ATP from ADP and Pi.

The complete list of predicted ATP synthases in U.u. is: UU053, UU054, UU128, UU129, UU130, UU132, UU133, UU134, UU135, UU136, UU137, and UU138.

This gene cluster is a likely candidate for the ATP synthase activity seen in conjunction with the urease present in Ureaplasma urealyticum (see UU427-UU434).

From: Molecular Biology and Pathogenicity of Mycoplasmas, Microbiology and Molecular Biology Reviews, Dec. 1998, p.1118-1119. Shmuel Razin, David Yogev, and Yehudith Naot.

The dependence of ureaplasmas on urea for growth has led to the hypothesis that intracellular urea hydrolysis and the resulting intracellular accumulation of ammonia/ammonium ions is coupled to ATP synthesis through a chemiosmotic type of mechanism. Experimental support for the generation of a transmembrane potential, with resultant ATP synthesis through the ureaplasmal F0F1-type ATPase, first provided by Romano et al. (1986, Medline: 3797330) was more recently extended and confirmed by Smith et al. (1993, Medline: 8501029) [...] It is worth mentioning at this point that the pH of the urogenital tract is usually on the acidic side of neutrality, corresponding to the pH values optimal for ureaplasma growth, maximum increase in delta P, maximum ammonia chemical potential, maximum urease activity, and maximum ATP generation.

Blast Summary:  PSI-Blast Search
A gapped BLAST reveals significant hits to the ATP synthase gamma chains of a number of organisms. For example: Residues 2-284 are 37% similar to that of M.gallisepticum (ATPG_MYCGA), residues 3-283 are 34% similar to that of M.pneumoniae (ATPG_MYCPN),and residues 3-283 are 32% similar to that of M.genitalium (ATPG_MYCGE).

In addition to these significant hits, other significant hits were made to the AtpG proteins of M.thermoacetica (1929512), B.subtilis (ATPG_BACSU), R.albus (pid:d1024568) and many others.

BLAST also reveals significant similarity to MG400, an ATP synthase F1, subunit gamma sequence.
No significant similarity to C.trachomatis or T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0224 is ehgpc-yu.
Cog name: ATP synthase gamma subunit.
Functional class: C.
BeTs to e--pc-yu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 4-28, 81-120 and 237-286 rank in the 100.00th percentile to Block BL00153(A,B and C respectively), described as ATP synthase gamma subunit proteins.

Residues 17-49 rank in the 96.04th percentile to Block PD02792A, described as Nonstructural Protein Alternative.


ProDom Summary:  Protein Domain Search
Residues 111-283 are 32% similar to a defined domain of ATPG_MYCGE.
Residues 2-106 are 37% similar to a defined domain of ATPG_MYCGA.

Paralogs:  Local Blast Search
No paralogs found in the U.urealyticum genome.

Pfam Summary:  Pfam Search
Residues 1 to 283 (E-value = 1.3e-60) place UU130 in the ATP-synt family which is described as ATP synthase (PF00231)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
44
transmembrane  
163  
183

PDB Hit:
gi|1827815|pdb|1COW|G Chain G, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B

Gene Protein Sequence:
MSLDAMKRKINSVQTTAKITNAMKLVATAKLKRQRDRLAAIKEYCHDYYD
VIGLLLSVVDDVEFLKIPNAKDRTLYITINSTMGLAGSYNYNVNKLISKI
VNETDITFTIGKKGHDFMRLSGRVDQVNTYLNLNDNDLTFDMSLQIAREA
LELYSQGEVNKICIIYTKFINAITFEVSVIDVLPFDKTALIKDHLAETIE
LAKDNIIFKPNKFELVKKILPTYIATVLYGSLIESKISENASRRNAMDAA
TKNAKALAENYKLIYNTLRQGKITREITEIVAGSDD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTTAGATGCAATGAAACGAAAAATTAACTCAGTTCAAACAACTGC
TAAGATTACGAATGCAATGAAACTAGTGGCAACTGCAAAATTAAAACGTC
AGCGTGATCGTTTAGCTGCAATTAAAGAATATTGTCATGATTACTATGAT
GTTATTGGGTTATTATTGTCTGTTGTTGATGATGTTGAATTTTTAAAAAT
TCCAAATGCGAAAGATCGAACTTTATATATCACTATTAATTCAACAATGG
GTTTAGCGGGTTCTTATAACTATAATGTTAATAAATTAATTTCTAAAATT
GTAAATGAAACTGATATAACATTTACAATTGGAAAAAAAGGACATGACTT
TATGCGTTTATCAGGTCGTGTTGATCAAGTTAATACTTATTTGAATTTAA
ATGATAATGATTTAACATTTGACATGAGTTTACAAATTGCGCGCGAGGCT
CTTGAATTATATTCACAAGGTGAAGTTAATAAAATTTGTATTATATATAC
TAAATTTATTAACGCAATTACTTTTGAAGTAAGTGTTATAGATGTTCTTC
CATTCGATAAGACAGCTTTAATTAAAGATCATCTTGCTGAAACTATTGAA
TTAGCAAAAGATAATATTATTTTTAAACCTAACAAGTTTGAGCTTGTTAA
AAAAATTCTACCTACTTATATTGCAACAGTTCTATATGGTTCATTAATTG
AATCAAAAATCTCTGAAAATGCATCACGACGCAATGCAATGGATGCAGCT
ACAAAAAATGCCAAAGCATTGGCTGAAAATTATAAATTAATTTACAATAC
ATTACGCCAAGGTAAAATTACTCGTGAAATTACTGAAATTGTTGCTGGTA
GTGATGATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy